KEGG   Saccharomyces cerevisiae (budding yeast): YGR012WHelp
Entry
YGR012W           CDS       T00005                                 

Gene name
MCY1
Definition
(RefSeq) putative cysteine synthase
  KO
K01738  cysteine synthase [EC:2.5.1.47]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00270  Cysteine and methionine metabolism
sce00920  Sulfur metabolism
sce01100  Metabolic pathways
sce01110  Biosynthesis of secondary metabolites
sce01130  Biosynthesis of antibiotics
sce01200  Carbon metabolism
sce01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    YGR012W (MCY1)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    YGR012W (MCY1)
Enzymes [BR:sce01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.47  cysteine synthase
     YGR012W (MCY1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP LacAB_rpiB
Motif
Other DBs
NCBI-GeneID: 852895
NCBI-ProteinID: NP_011526
SGD: S000003244
UniProt: P53206
Position
VII:513159..514340
Genome map
AA seq 393 aa AA seqDB search
MSCSQNKTSVSLAWRECISIASVLIGAYASYKYYKLFKTRDIPRPKEGVEELIGNTPLVK
IRSLTKATGVNIYAKLELCNPAGSAKDRVALNIIKTAEELGELVRGEPGWVFEGTSGSTG
ISIAVVCNALGYRAHISLPDDTSLEKLALLESLGATVNKVKPASIVDPNQYVNAAKKACN
ELKKSGNGIRAVFADQFENEANWKVHYQTTGPEIAHQTKGNIDAFIAGCGTGGTITGVAK
FLKERAKIPCHVVLADPQGSGFYNRVNYGVMYDYVEKEGTRRRHQVDTIVEGIGLNRITH
NFHMGEKFIDESIRVNDNQAIRMAKYLSVNDGLFVGSSTAINAVAAIQVAKTLPHGSNIV
IIACDSGSRHLSKFWKEAKEIDHDVSLEEVINI
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgtcctgttctcaaaataagacttctgtcagtctggcctggcgtgaatgcatatccatc
gcttccgtcctaattggcgcgtatgcatcatacaaatactataagctgttcaaaacacgc
gatattccacgtccaaaagaaggcgttgaagaactcataggaaacactcctctggttaag
atcagatctcttaccaaggctactggagttaacatttacgctaagttggagttatgcaac
ccagcaggaagtgctaaggatagagtggctttaaacatcataaagacggctgaggaatta
ggcgagctcgtcagaggtgaacctggctgggtatttgaaggaacaagtgggtcgactggt
atctctatagcagtggtctgtaatgcgttgggttatagggcacacatttctttgcccgat
gacacatcgctagaaaaattggcattactagaaagcctcggtgctactgttaataaggtt
aagcccgctagtattgtcgatccaaaccaatacgtaaatgccgccaaaaaggcatgtaat
gaactaaagaagagtggtaatggaataagagcagtttttgccgatcagttcgaaaacgaa
gccaactggaaagtacattaccagaccacaggcccagaaattgcccatcaaactaaggga
aatattgacgcattcattgctggctgcggtactggtggcaccataactggtgtggcaaaa
ttcttaaaggaaagagcaaagataccttgccatgtcgttctagcggatccacaaggatct
ggcttttataatagagtcaactatggcgtgatgtatgactatgtagagaaggaaggtact
agaagaaggcatcaagttgacactatcgtagaagggattgggttaaacagaatcactcat
aattttcatatgggcgaaaagtttattgatgaatcaatacgagtcaacgataatcaagcc
attagaatggcaaaatacctatcggtaaacgacgggctattcgtggggagtagtacagct
attaatgcggtagccgctattcaggttgcaaaaacgcttcctcacggctcaaacattgtg
attattgcatgcgacagcggttcaagacacctaagtaaattctggaaagaagctaaagaa
atcgatcacgacgtgtcattagaagaagtaataaatatctaa

DBGET integrated database retrieval system