KEGG   Saccharomyces cerevisiae (budding yeast): YGR013WHelp
Entry
YGR013W           CDS       T00005                                 

Gene name
SNU71
Definition
(RefSeq) Snu71p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FOP_dimer pXO2-72 PWI GET2
Motif
Other DBs
NCBI-GeneID: 852896
NCBI-ProteinID: NP_011527
SGD: S000003245
UniProt: P53207
Structure
PDB: 

Position
VII:514554..516416
Genome map
AA seq 620 aa AA seqDB search
MRDIVFVSPQLYLSSQEGWKSDSAKSGFIPILKNDLQRFQDSLKHIVDARNSLSETLLNS
NDDGSIHNSDQNTGLNKDKEASIADNNSANKCATSSSRYQELKQFLPISLDQQIHTVSLQ
GVSSSFSRGQIESLLDHCLNLALTETQSNSALKVEAWSSFSSFLDTQDIFIRFSKVDEDE
AFVNTLNYCKALFAFIRKLHEDFKIELHLDLNTKEYVEDRTGTIPSVKPEKASEFYSVFK
NIEDQTDERNSKKEQLDDSSTQYKVDTNTLSDLPSDALDQLCKDIIEFRTKVVSIEKEKK
MKSTYEESRRQRHQMQKVFDQIRKNHSGAKGSANTEEEDTNMEDEDEEDDTEDDLALEKR
KEERDLEESNRRYEDMLHQLHSNTEPKIKSIRADIMSAENYEEHLEKNRSLYLKELLHLA
NDVHYDHHRSFKEQEERRDEEDRAKNGNAKELAPIQLSDGKAISAGKAAAITLPEGTVKS
ENYNADKNVSESSEHVKIKFDFKKAIDHSVESSSEDEGYRESELPPTKPSERSAAEDRLP
FTADELNIRLTNLKESRYVDELVREFLGVYEDELVEYILENIRVNQSKQALLNELRETFD
EDGETIADRLWSRKEFRLGT
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atgagggatattgtatttgtatcaccgcagctgtatttgtcatcacaggagggttggaaa
agtgattctgccaaaagtgggttcatccctatcctcaaaaatgatctacaacgttttcag
gactcattaaaacatatagttgacgccagaaacagcttatcagagacactgctaaatagc
aacgatgatgggagtatacacaattctgaccagaatactggtttgaataaagacaaagag
gcttcaatagcagataacaatagtgctaacaagtgcgccacaagctcttcccgttaccaa
gagctcaaacaatttcttcccatttccttagaccaacagattcatacagtatctttacaa
ggtgtctcttcatcattttctcgcggacagatagaatcattgctagaccactgtttgaat
ttagcgttgactgaaactcaaagcaattccgcattgaaagtagaagcttggtcttctttt
tcttcgtttttagatacccaggacatttttataagattcagtaaggttgatgaagatgag
gcatttgttaatacgctgaactactgcaaagccttattcgcgtttattagaaagctacat
gaggatttcaagattgagttacacttggatttgaacacaaaagaatatgtcgaagaccga
acaggaactataccgagtgttaagccagaaaaggctagcgaattttattctgttttcaaa
aacattgaagatcaaacagacgaaagaaattcaaagaaagaacagttggatgactcttcc
acacaatacaaagtggatacaaacactttaagtgatttgccatcggatgctttggaccaa
ttgtgcaaggatataatagaatttaggacaaaagttgtcagtatagagaaagaaaaaaaa
atgaaaagtacgtacgaggaaagtaggcgtcaaagacaccaaatgcaaaaagtttttgat
caaataaggaaaaaccactcaggagccaaagggagcgccaatacagaggaggaggatact
aatatggaagatgaagatgaggaggatgacactgaagacgaccttgccttagagaagaga
aaagaagaaagagacctggaagaatcaaatcgtagatatgaggatatgttacaccaatta
cattccaatacagagcctaagataaaatccattagggctgatatcatgagtgctgaaaac
tatgaggaacatttggagaaaaatcgctcattatatttgaaggagctattacaccttgcc
aacgacgttcattacgaccaccatagatctttcaaggagcaagaggaaagaagggacgaa
gaggatagagctaaaaatggaaatgcaaaggaactggcgcctatacaactatcggatggt
aaggccatatctgcagggaaggctgccgccatcacccttcctgaaggcactgtgaagagc
gagaactataacgcggacaagaatgtgtctgagagctcagaacacgtcaagatcaaattc
gactttaagaaggctattgatcactcagttgaaagctctagcgaagacgagggatacaga
gagagcgagctacctccaacaaaaccctccgagagaagcgcggcagaggaccgtttgcca
tttacagcagatgaactgaacataagactaactaatctgaaggaatcgcgctacgtggac
gaactggtgcgtgaattcctcggcgtctacgaggacgagctggtggaatacattcttgag
aacatccgcgtgaaccagagcaaacaggcccttttaaatgagctaagggagactttcgac
gaggacggggaaacgatagctgatagactgtggagtcgtaaagaatttcgcttggggacc
tga

DBGET integrated database retrieval system