KEGG   Saccharomyces cerevisiae (budding yeast): YGR014WHelp
Entry
YGR014W           CDS       T00005                                 

Gene name
MSB2
Definition
(RefSeq) Msb2p
  KO
K19849  signaling mucin MSB2
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04011  MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04011 MAPK signaling pathway - yeast
    YGR014W (MSB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Orf78
Motif
Other DBs
NCBI-GeneID: 852897
NCBI-ProteinID: NP_011528
SGD: S000003246
UniProt: P32334
Position
VII:516943..520863
Genome map
AA seq 1306 aa AA seqDB search
MQFPFACLLSTLVISGSLARASPFDFIFGNGTQQAQSQSESQGQVSFTNEASQDSSTTSL
VTAYSQGVHSHQSATIVSATISSLPSTWYDASSTSQTSVSYASQESDYAVNQNSWSASTN
QLPSTSTTSYYAPTFSTSADFAASSVNAASDVSTASVPIDTSANSIPFTTTSNIETTTSA
PLTSDTPLISTSTMSAADNVFSSANPISASLTTTDSSESFDQTSTAGAIPVQSSADFSSS
SEILVQSSADFSSPSSPTTTDISLSAAPLQTSESSSFTTASAALPVSSTDVDGSSASPVV
SMSAAGQIASSSSTDNPTMSETFSLTSTEVDGSDVSSTVSALLSAPFLQTSTSNSFSIVS
PSVSFVPSQSSSDVASSSTANVVSSSFSDIPPQTSTSGSVVSVAQSASALAFQSSTEVYG
ASASSTMSSLLSTTSLQSTTLDSSSLASSSASSSDLTDYGVSSTASIPLLSASEQASTSS
SFSVVSPSVSFVPSQSSSDVASTSAPSVVSSSFSYTSLQAGGSSMTNPSSSTIVYSSSTG
SSEESAASTASATLSGSSSTYMAGNLQSQPPSTSSLLSESQATSTSAVLASSSVSTTSPY
TTAGGASTEASSLISSTSAETSQVSYSQSTTALQTSSFASSSTTEGSETSSQGFSTSSVL
VQMPSSISSEFSPSQTTTQMNSASSSSQYTISSTGILSQVSDTSVSYTTSSSSVSQVSDT
PVSYTTSSSSVSQVSDTPVSYTTSSSSVSQVSDTPVSYTTSSSSVSQVSDTPVSYTTSSS
SVSQVSDTSVPSTSSRSSVSQVSDTPVPSTSSRSSVSQTSSSLQPTTTSSQRFTISTHGA
LSESSSVSQQASEITSSINATASEYHSIQTTAATQSTTLSFTDANSSSASAPLEVATSTP
TPSSKASSLLLTPSTSSLSQVATNTNVQTSLTTESTTVLEPSTTNSSSTFSLVTSSDNNW
WIPTELITQAPEAASTASSTVGGTQTMTLPHAIAAATQVPEPEGYTLITIGFKKALNYEF
VVSEPKSSAQIFGYLPEALNTPFKNVFTNITVLQIVPLQDDSLNYLVSVAEVYFPTAEIE
ELSNLITNSSSAFYTDGMGTAKSMAAMVDSSIPLTGLLHDSNSNSGGSSDGSSSSNSNSG
SSGSGSNSNSGVSSSSGNSYQDAGTLEYSSKSNSNVSTSSKSKKKIIGLVIGVVVGGCLY
ILFMIFAFKYIIRRRIQSQEIIKNPEISSISSSEFGGEKNYNNEKRMSVQESITQSMRIQ
NWMDDSYYGHGLTNNDSTPTRHNTSSSIPKISRPIASQNSLGWNEV
NT seq 3921 nt NT seq  +upstreamnt  +downstreamnt
atgcagtttccattcgcttgtctcctatcgacccttgtaattagtgggtcattggcccgg
gccagccccttcgactttatattcggcaatggaacgcaacaagctcagagccaaagcgag
agtcaaggtcaagtttctttcaccaatgaagcttctcaggatagttccaccacctctttg
gtaacagcctattctcaaggtgttcattcgcaccagtctgcaacaatagtgagtgccaca
atctcttccctcccatctacttggtatgatgcgagctccacttcccagacttctgtgtca
tatgccagtcaagaatccgactatgccgttaatcaaaactcttggagcgcgtctactaat
caactgccatctaccagtacgacaagctactatgcgccaaccttcagtacatcggccgat
tttgctgcttctagtgtaaatgcagcttctgatgtctccactgccagtgttcccattgat
acgagtgctaattctatccctttcacaactacaagtaacatagagactacaacgagtgca
cctctcacttcggacactccacttatttccactagtacgatgtccgcagctgataacgta
ttttcgtcagcaaaccctatttctgcctccctaacaaccaccgatagttcagaaagtttt
gaccaaacttcgactgctggtgccattccggtgcaaagttcagcagattttagtagttct
agtgaaattttagtacaaagttcggcggatttcagtagccctagttctccaactactacc
gatatatcgctatcagctgccccactgcaaacaagtgaatcaagcagttttaccactgca
tcagcagctctaccagtaagttcaacagacgttgatggctcaagcgcctcacctgtagtg
agcatgagcgccgcaggacaaatagctagctcaagcagcacagataatccaactatgtca
gaaaccttttcgttaacatctacagaagttgatggttccgatgtttcatcaacagtgagc
gcattattatcggctccttttttacaaacaagtacttccaacagtttcagcattgttagc
ccatcggtatcttttgttccatcacagagttcctcagacgttgctagctccagtactgca
aatgtagttagttcatccttttctgatattccaccgcaaactagtacctcagggagcgta
gtttcggtagcgcaatccgcatctgccctcgcatttcaaagttcaacagaggtatatggt
gccagtgcctcgagcacaatgagttcattattatcaactacttcgctacagtctactact
ttggatagctcaagtttagctagctcctctgcgtcgagttcagaccttacagattatggc
gtctccagtacagcaagcataccgctgttgtcagcctcagaacaagcaagtacttccagc
agttttagcgttgttagcccttcggtatcttttgttccatcacaaagttcctcagatgtt
gctagcaccagtgctccaagtgtagttagttcatccttttcttatacttcactgcaagca
ggtggctctagcatgaccaatccctcttcatcaactatagtatattcaagtagtactggc
agttctgaggaatccgctgcatctacagcttctgcaacactgtcgggctcctcgtctact
tatatggcaggaaatttgcaatcacagcctccatccacttcaagtttgctttcggagtct
caagctacaagcacttcagctgtgctagctagcagttctgtttctacaacttcaccctat
accactgcaggtggtgcatctacagaggcctcatccctcatatcatctacatctgcggaa
acttcccaggtaagttattcacaaagcacaactgcattgcaaacttcctcattcgcatcg
tcttcaacaacagaaggaagtgaaacatctagtcaaggtttttctaccagctctgtttta
gttcaaatgccttcttcgatttccagcgaattctcaccctctcagacgacaactcaaatg
aattctgcaagctcatcatctcagtacactatatcatccactggtatactttctcaggtt
tcagacacatcggtgtcttatacaacttcaagttcgtctgtttctcaagtttcagacaca
ccagtttcttatacaacttcaagttcgtctgtttctcaagtttcagacacaccggtttct
tatacaacttcaagttcgtctgtttctcaagtttcagacacaccagtttcttatacaact
tcaagttcatctgtttctcaagtttcagacacaccggtttcttatacaacttcaagttcg
tccgtttctcaagtttcagacacgtcagtaccttctacaagttccagatcgtccgtttct
caagtctcagacactccggtgccttctacaagttcaaggtcgtccgtttctcaaacatct
agctcactacagcccaccactacatcctcccaacgtttcaccatttccactcatggagcg
ctttctgaaagtagttctgttagccaacaagcttctgagattactagctcaatcaatgca
acagcttccgaataccatagcatccagacaaccgcggctactcaatccacaactctatct
tttaccgacgcaaacagcagttctgcttccgctccattggaagtggcaacgtctacgcca
accccatcttcaaaggcatcctctctgttgcttacaccatcaacatcctctttaagtcag
gttgctacaaatactaatgtacagacgagtttaacaacggaatcgacgaccgttttagaa
ccatcaacgactaacagttccagtacgtttagtctggtcacttcaagtgacaacaattgg
tggattccaactgagttaatcacgcaggcaccagaagctgcatccactgcatcttctacc
gttggaggaacacaaactatgactttgccccatgcaattgcagccgcgacacaagttccc
gagcctgagggctacaccctaatcacaatagggttcaaaaaagctttgaactacgaattt
gttgtatcagaaccaaaatcatcggctcaaatcttcggatacttgcctgaagctctgaac
acaccttttaagaacgtattcacaaacattacggtactacaaatagtgccattacaggat
gactcactcaactacttagtaagtgttgctgaagtatactttccaactgcagaaatagag
gagctgtcaaatctaattaccaactcttcaagcgctttttacacggatggaatgggtaca
gcaaaatctatggctgcaatggttgattcctcaataccgctaacgggcctcttacacgat
agtaacagcaactctggcggatcttcggacggatcctcctccagtaattcgaactcagga
tcttcaggttcaggatctaattcgaactccggtgtgtcttcatcttccggaaattcctat
caagatgccggtactttggaatattcatccaaatctaactccaacgtatccacttctagc
aaatcaaagaaaaaaatcattggtttagttatcggcgttgttgttggtggatgcttatat
attttattcatgatttttgctttcaagtatatcataagaaggcggattcaaagtcaagaa
attatcaagaacccagaaatttccagtatcagttcaagtgaatttggtggagagaaaaat
tacaataatgaaaagagaatgagcgttcaagaatccataacacaatctatgcgaattcaa
aattggatggatgatagttactatggtcacgggttgacaaataatgactcaactccaacc
aggcacaatacatcgagttccataccaaaaatttcaagaccaattgctagccaaaactcc
ctgggttggaacgaagtttga

DBGET integrated database retrieval system