KEGG   Saccharomyces cerevisiae (budding yeast): YGR017WHelp
Entry
YGR017W           CDS       T00005                                 

Definition
(RefSeq) hypothetical protein
  KO
K00275  pyridoxamine 5'-phosphate oxidase [EC:1.4.3.5]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00750  Vitamin B6 metabolism
sce01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    YGR017W
Enzymes [BR:sce01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.5  pyridoxal 5'-phosphate synthase
     YGR017W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridox_oxase_2
Motif
Other DBs
NCBI-GeneID: 852900
NCBI-ProteinID: NP_011531
SGD: S000003249
UniProt: P53210
Position
VII:523787..524680
Genome map
AA seq 297 aa AA seqDB search
MSHQMAPWIPMFIQSCKNNTEPFVSFQFATVDELTNKPRCRTVVFRDFLFHDKRTNVLTF
NTDMRSSKITESFITPNSNNSSDSKRCETPFFEACFYFPETWEQYRFSGQCFTISKQFKK
IPAEIVTKYDIFSPRFSETNDDSTDEEIDTPINDDDDDDKNNDADNNDINEDNKLIESIE
NDEHHEDEDDYYPQPQEWEAELLRQWSSLSRHTKSLYRKPAPGQKLTSETSKQLDKLHRG
VDGAKEDAGLENFGIVCLCVDSVDFLNLKEGRGGERWIFQKTDGKDEDLWEEQEVCP
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcatcaaatggcgccatggatacccatgtttattcaatcgtgcaaaaataacact
gaaccgtttgtatcatttcaatttgctactgttgacgaactaacgaacaaaccacgttgt
agaacggtagtgttcagagattttttatttcatgacaaaagaactaatgtgttgactttt
aacactgatatgaggagctcaaagataactgaatcatttataactccaaattcaaataac
tctagcgacagcaaaagatgtgagactccatttttcgaagcatgtttctatttcccggaa
acttgggagcagtatcgcttcagtggccaatgctttacaatatctaaacaatttaagaaa
ataccggctgagattgtaaccaagtatgacatattttcaccgcggttttcagagacaaat
gatgacagcactgacgaagaaatagatactccaattaacgacgacgacgacgacgataaa
aataatgacgccgacaataatgacattaacgaagataacaaacttatagaatccatagag
aacgatgaacaccatgaggatgaagacgactactaccctcaaccacaagaatgggaggct
gaattactaagacaatggtcctctctatcaaggcataccaagtcattgtataggaagcca
gccccgggccagaaacttacctctgaaactagcaaacaactggacaaactccatagagga
gttgacggtgctaaagaggacgctggactggaaaactttggtattgtctgtctttgtgtt
gattctgttgattttttgaacttgaaagagggaagaggtggtgaaagatggattttccag
aaaaccgacggcaaagacgaagatctgtgggaggaacaagaagtgtgtccgtga

DBGET integrated database retrieval system