KEGG   Saccharomyces cerevisiae (budding yeast): YGR019WHelp
Entry
YGR019W           CDS       T00005                                 

Gene name
UGA1
Definition
(RefSeq) 4-aminobutyrate transaminase
  KO
K13524  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00250  Alanine, aspartate and glutamate metabolism
sce00280  Valine, leucine and isoleucine degradation
sce00410  beta-Alanine metabolism
sce00640  Propanoate metabolism
sce00650  Butanoate metabolism
sce01100  Metabolic pathways
Module
sce_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    YGR019W (UGA1)
   00650 Butanoate metabolism
    YGR019W (UGA1)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    YGR019W (UGA1)
   00280 Valine, leucine and isoleucine degradation
    YGR019W (UGA1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    YGR019W (UGA1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sce01007]
    YGR019W (UGA1)
Enzymes [BR:sce01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     YGR019W (UGA1)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     YGR019W (UGA1)
Amino acid related enzymes [BR:sce01007]
 Aminotransferase (transaminase)
  Class III
   YGR019W (UGA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-GeneID: 852902
NCBI-ProteinID: NP_011533
SGD: S000003251
UniProt: P17649
Position
VII:525229..526644
Genome map
AA seq 471 aa AA seqDB search
MSICEQYYPEEPTKPTVKTESIPGPESQKQLKELGEVFDTRPAYFLADYEKSLGNYITDV
DGNTYLDLYAQISSIALGYNNPALIKAAQSPEMIRALVDRPALGNFPSKDLDKILKQILK
SAPKGQDHVWSGLSGADANELAFKAAFIYYRAKQRGYDADFSEKENLSVMDNDAPGAPHL
AVLSFKRAFHGRLFASGSTTCSKPIHKLDFPAFHWPHAEYPSYQYPLDENSDANRKEDDH
CLAIVEELIKTWSIPVAALIIEPIQSEGGDNHASKYFLQKLRDITLKYNVVYIIDEVQTG
VGATGKLWCHEYADIQPPVDLVTFSKKFQSAGYFFHDPKFIPNKPYRQFNTWCGEPARMI
IAGAIGQEISDKKLTEQCSRVGDYLFKKLEGLQKKYPENFQNLRGKGRGTFIAWDLPTGE
KRDLLLKKLKLNGCNVGGCAVHAVRLRPSLTFEEKHADIFIEALAKSVNEL
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgtctatttgtgaacaatactacccagaagagccaaccaaaccaactgttaagaccgag
tccattcctggtcctgaatcccagaagcagttaaaggaactgggtgaagtttttgacaca
agaccagcatattttttggctgattatgagaaatctttaggtaactatatcactgatgtg
gatgggaacacatatttggatttgtatgcccaaatctcttcaattgcacttggttataac
aaccctgctttgatcaaggcagcacaatcaccagaaatgatccgtgctttggtcgaccgt
cctgccttaggtaacttcccatctaaggatttagacaagatattgaagcaaatattgaaa
tctgcgccaaagggtcaagatcacgtctggtcagggctttccggtgcagatgccaatgaa
ttagcgttcaaggctgcctttatttattaccgtgccaaacaaaggggctatgatgccgat
ttttctgaaaaggaaaacttgtctgtcatggacaatgacgcccctggcgcccctcatctt
gccgtactatcgttcaagagagcgttccacggtagattgtttgcctccggttccacaact
tgttctaaaccaattcacaagttggatttcccagccttccactggcctcatgctgagtat
ccatcttaccaatacccattagatgaaaattctgatgcaaaccgtaaagaggatgaccat
tgcttggccattgttgaagaattaatcaaaacctggtctattccagttgctgccttaatc
atcgaaccaattcaatctgagggaggtgataaccacgcttctaagtatttcttacaaaag
ctaagagacattaccttgaagtataacgttgtctacatcatagatgaagtgcaaacaggt
gtcggagccaccggtaagctatggtgtcatgagtacgccgatattcaaccacctgtggat
ttagtgaccttttccaagaaattccaaagtgcaggatatttcttccacgaccctaaattc
attccaaacaaaccatacagacaattcaacacatggtgtggtgaacctgcaagaatgatc
attgcaggtgccattggacaggaaatctccgacaagaagttgactgaacaatgttcaaga
gtaggtgattatttgttcaagaaattggagggtttgcagaagaaataccctgaaaacttt
caaaacttgagaggtaaaggaagaggcacattcattgcctgggatttgcctactggtgag
aagagagacttactattgaagaaattgaagttgaatggttgcaacgttggtggatgtgca
gtccatgcagtgagattaagaccttcattaacattcgaggagaagcatgctgatatcttt
attgaagcattagccaaatcagttaatgaattatga

DBGET integrated database retrieval system