KEGG   Saccharomyces cerevisiae (budding yeast): YGR020CHelp
Entry
YGR020C           CDS       T00005                                 

Gene name
VMA7
Definition
(RefSeq) H(+)-transporting V1 sector ATPase subunit F
  KO
K02151  V-type H+-transporting ATPase subunit F
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00190  Oxidative phosphorylation
sce01100  Metabolic pathways
sce04145  Phagosome
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    YGR020C (VMA7)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    YGR020C (VMA7)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-synt_F
Motif
Other DBs
NCBI-GeneID: 852903
NCBI-ProteinID: NP_011534
SGD: S000003252
UniProt: P39111
Structure
PDB: 

Position
VII:complement(526973..527329)
Genome map
AA seq 118 aa AA seqDB search
MAEKRTLIAVIADEDTTTGLLLAGIGQITPETQEKNFFVYQEGKTTKEEITDKFNHFTEE
RDDIAILLINQHIAENIRARVDSFTNAFPAILEIPSKDHPYDPEKDSVLKRVRKLFGE
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atggctgagaaacgtactcttatagctgtgatagctgacgaagatactacaactggttta
ttgttagccgggattggacaaatcactcctgaaacccaagaaaagaacttttttgtttac
caagaaggtaagactactaaggaggaaatcactgacaagtttaatcactttactgaagag
agagacgatattgccatccttctaatcaaccaacatatcgcggaaaacataagagctaga
gtggactccttcaccaatgcgttccctgctattttagaaattccatctaaagatcatccc
tacgaccctgaaaaggactctgtattgaagagagtcagaaagttgttcggtgagtaa

DBGET integrated database retrieval system