KEGG   Saccharomyces cerevisiae (budding yeast): YGR026WHelp
Entry
YGR026W           CDS       T00005                                 

Definition
(RefSeq) hypothetical protein
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 852910
NCBI-ProteinID: NP_011540
SGD: S000003258
UniProt: P53217
Position
VII:532985..533821
Genome map
AA seq 278 aa AA seqDB search
MAKTIKVIRKKDPKKKNLSDPLAKQKLVWKIGHVLTLVFGLLFSITYFYHVLIFFKYRSW
KWLFLRVNKNYSFIQSKRWYMKLLSWSPQVMYRLSLIGVFMSESVTMQQNWVGLNPTWND
LLSSENFHTLLIACLWFFGGGKSFYKILPYMILSYLHLTKMNYELNANKEEKIPLTPKDR
KMLHLLAYSELLVILALTLDTILFKTGTSGFMLVIYVGIYWLRLNFSPYAQVAVLELLVK
FEKYVPKKYRDKWQVIKNFIYMKMKEHEKRTEEVARYA
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagactatcaaagttatcaggaagaaggaccccaaaaagaagaacctatccgat
cctttagcaaaacaaaaactagtttggaaaatcggacacgttttaactttagtttttggt
ttattattttctatcacgtatttctaccatgtcctaatcttcttcaaatatcgttcctgg
aagtggttgttcttaagggtcaataaaaattactcgtttattcaaagtaagagatggtac
atgaaacttttgagttggagcccacaggtaatgtaccgtttgtcattaattggcgtattt
atgtctgagtccgtcacaatgcaacagaactgggttggacttaaccctacttggaatgac
cttttgtcctctgagaactttcatacccttttgattgcctgtttatggttctttggtggt
ggtaagtctttttacaagattttgccttacatgattttaagttatctacacctaactaaa
atgaactacgaattgaatgctaacaaagaagaaaagatccctttaacacccaaagacaga
aaaatgctacacttacttgcgtactctgaattacttgttatcttagcgctaacactagac
actatattgtttaagacgggtacatccggatttatgctcgtcatttatgttggtatttat
tggttgaggttgaacttctctccatacgcacaagtggctgttttggagttacttgtcaag
tttgaaaaatacgtccccaaaaaatatagagacaaatggcaggttataaagaactttatt
tatatgaaaatgaaggagcacgaaaagagaacagaagaagttgccagatacgcgtaa

DBGET integrated database retrieval system