KEGG   Saccharomyces cerevisiae (budding yeast): YGR027CHelp
Entry
YGR027C           CDS       T00005                                 

Gene name
RPS25A, RPS31A
Definition
(RefSeq) ribosomal 40S subunit protein S25A
  KO
K02975  small subunit ribosomal protein S25e
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03010  Ribosome
Module
sce_M00177  Ribosome, eukaryotes
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    YGR027C (RPS25A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:sce03011]
    YGR027C (RPS25A)
Ribosome [BR:sce03011]
 Ribosomal Proteins
  Eukaryotes
   Small subunit
    YGR027C (RPS25A)
  Archaea
    YGR027C (RPS25A)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S25 FtsK_gamma EAP30 HTH_CodY
Motif
Other DBs
NCBI-GeneID: 852911
NCBI-ProteinID: NP_011541
SGD: S000003259
UniProt: Q3E792
Structure
PDB: 

Position
VII:complement(534132..534458)
Genome map
AA seq 108 aa AA seqDB search
MPPKQQLSKAAKAAAALAGGKKSKKKWSKKSMKDRAQHAVILDQEKYDRILKEVPTYRYV
SVSVLVDRLKIGGSLARIALRHLEKEGIIKPISKHSKQAIYTRATASE
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atgcctccaaagcaacaattatctaaagctgccaaagccgctgctgcccttgctggtggt
aagaagtctaagaagaagtggtccaaaaagtccatgaaagacagagctcaacacgctgtc
attttagaccaagagaagtacgacagaatcttgaaggaagttccaacttacagatacgtt
tctgtctctgttttggtcgacagattaaagattggtggttctttagctagaattgctttg
agacacttggaaaaggaaggtatcatcaagccaatctccaagcactccaagcaagctatc
tacaccagagctactgcttctgaataa

DBGET integrated database retrieval system