KEGG   Saccharomyces cerevisiae (budding yeast): YGR029WHelp
Entry
YGR029W           CDS       T00005                                 

Gene name
ERV1
Definition
(RefSeq) flavin-linked sulfhydryl oxidase
  KO
K17783  mitochondrial FAD-linked sulfhydryl oxidase [EC:1.8.3.2]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:sce03029]
    YGR029W (ERV1)
Enzymes [BR:sce01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.3  With oxygen as acceptor
    1.8.3.2  thiol oxidase
     YGR029W (ERV1)
Mitochondrial biogenesis [BR:sce03029]
 Mitochondrial protein import machinery
  Inter membrane space
   Mitochondrial intermembrane space assembly (MIA) complex
    YGR029W (ERV1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Evr1_Alr
Motif
Other DBs
NCBI-GeneID: 852916
NCBI-ProteinID: NP_011543
SGD: S000003261
UniProt: P27882
Structure
PDB: 

Position
VII:join(543553..543638,543722..544205)
Genome map
AA seq 189 aa AA seqDB search
MKAIDKMTDNPPQEGLSGRKIIYDEDGKPCRSCNTLLDFQYVTGKISNGLKNLSSNGKLA
GTGALTGEASELMPGSRTYRKVDPPDVEQLGRSSWTLLHSVAASYPAQPTDQQKGEMKQF
LNIFSHIYPCNWCAKDFEKYIRENAPQVESREELGRWMCEAHNKVNKKLRKPKFDCNFWE
KRWKDGWDE
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcaatagataaaatgacggataatccaccacaagaaggcttaagtgggaggaaa
ataatatatgacgaagatggcaaaccttgccgatcatgtaacaccctacttgactttcag
tacgtgaccgggaagatatctaatggcctgaagaacctctcatctaacggtaaactagca
ggtacgggggctctcactggcgaagcttcagagttgatgcctggctcaagaacatacagg
aaggttgaccctcctgacgtagagcaactaggtagatcttcatggacgctgttacactct
gtagctgccagctatcctgctcaacctacagaccaacagaagggtgaaatgaaacagttc
ttgaatatcttctcacatatttatccttgcaactggtgtgctaaagactttgaaaaatat
atcagagaaaatgcaccacaagttgagtcaagagaagaacttgggaggtggatgtgtgaa
gcccacaataaagtcaataagaaattgaggaagcccaaatttgactgtaatttctgggaa
aaaagatggaaggacggctgggacgaataa

DBGET integrated database retrieval system