KEGG   Saccharomyces cerevisiae (budding yeast): YGR032WHelp
Entry
YGR032W           CDS       T00005                                 

Gene name
GSC2, FKS2
Definition
(RefSeq) 1,3-beta-glucan synthase GSC2
  KO
K00706  1,3-beta-glucan synthase [EC:2.4.1.34]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00500  Starch and sucrose metabolism
sce01100  Metabolic pathways
sce04011  MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    YGR032W (GSC2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04011 MAPK signaling pathway - yeast
    YGR032W (GSC2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:sce01003]
    YGR032W (GSC2)
Enzymes [BR:sce01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.34  1,3-beta-glucan synthase
     YGR032W (GSC2)
Glycosyltransferases [BR:sce01003]
 Polysaccharide
  Structural polysaccharide
   YGR032W (GSC2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucan_synthase FKS1_dom1
Motif
Other DBs
NCBI-GeneID: 852920
NCBI-ProteinID: NP_011546
SGD: S000003264
UniProt: P40989
Position
VII:548264..553951
Genome map
AA seq 1895 aa AA seqDB search
MSYNDPNLNGQYYSNGDGTGDGNYPTYQVTQDQSAYDEYGQPIYTQNQLDDGYYDPNEQY
VDGTQFPQGQDPSQDQGPYNNDASYYNQPPNMMNPSSQDGENFSDFSSYGPPSGTYPNDQ
YTPSQMSYPDQDGSSGASTPYGNGVVNGNGQYYDPNAIEMALPNDPYPAWTADPQSPLPI
EQIEDIFIDLTNKFGFQRDSMRNMFDHFMTLLDSRSSRMSPEQALLSLHADYIGGDTANY
KKWYFAAQLDMDDEIGFRNMKLGKLSRKARKAKKKNKKAMQEASPEDTEETLNQIEGDNS
LEAADFRWKSKMNQLSPFEMVRQIALFLLCWGEANQVRFTPECLCFIYKCASDYLDSAQC
QQRPDPLPEGDFLNRVITPLYRFIRSQVYEIVDGRYVKSEKDHNKVIGYDDVNQLFWYPE
GIAKIVMEDGTRLIDLPAEERYLKLGEIPWDDVFFKTYKETRSWLHLVTNFNRIWIMHIS
VYWMYCAYNAPTFYTHNYQQLVDNQPLAAYKWATAALGGTVASLIQVAATLCEWSFVPRK
WAGAQHLSRRFWFLCVIMGINLGPVIFVFAYDKDTVYSTAAHVVGAVMFFVAVATLVFFS
VMPLGGLFTSYMKKSTRSYVASQTFTASFAPLHGLDRWMSYLVWVTVFAAKYAESYFFLI
LSLRDPIRILSTTSMRCTGEYWWGNKICKVQPKIVLGLMIATDFILFFLDTYLWYIVVNT
VFSVGKSFYLGISILTPWRNIFTRLPKRIYSKILATTDMEIKYKPKVLISQIWNAIIISM
YREHLLAIDHVQKLLYHQVPSEIEGKRTLRAPTFFVSQDDNNFETEFFPRDSEAERRISF
FAQSLSTPIPEPLPVDNMPTFTVLTPHYAERILLSLREIIREDDQFSRVTLLEYLKQLHP
VEWDCFVKDTKILAEETAAYENNEDEPEKEDALKSQIDDLPFYCIGFKSAAPEYTLRTRI
WASLRSQTLYRTISGFMNYSRAIKLLYRVENPEIVQMFGGNADGLERELEKMARRKFKFL
VSMQRLAKFKPHELENAEFLLRAYPDLQIAYLDEEPPLNEGEEPRIYSALIDGHCEILEN
GRRRPKFRVQLSGNPILGDGKSDNQNHALIFYRGEYIQLIDANQDNYLEECLKIRSVLAE
FEELGIEQIHPYTPGLKYEDQSTNHPVAIVGAREYIFSENSGVLGDVAAGKEQTFGTLFA
RTLAQIGGKLHYGHPDFINATFMTTRGGVSKAQKGLHLNEDIYAGMNAVLRGGRIKHCEY
YQCGKGRDLGFGTILNFTTKIGAGMGEQMLSREYYYLGTQLPIDRFLTFYYAHPGFHLNN
LFIQLSLQMFMLTLVNLHALAHESILCVYDRDKPITDVLYPIGCYNFHPAIDWVRRYTLS
IFIVFWIAFVPIVVQELIERGLWKATQRFFRHILSLSPMFEVFAGQIYSSALLSDIAVGG
ARYISTGRGFATSRIPFSILYSRFAGSAIYMGSRSMLMLLFGTVAHWQAPLLWFWASLSA
LIFAPFIFNPHQFAWEDFFLDYRDYIRWLSRGNNKYHRNSWIGYVRMSRSRVTGFKRKLV
GDESEKSAGDASRAHRTNLIMAEIIPCAIYAAGCFIAFTFINAQTGVKTTDEDRVNSTLR
IIICTLAPIVIDIGVLFFCMGLSCCSGPLLGMCCKKTGSVMAGIAHGIAVVVHIVFFIVM
WVLEGFSFVRMLIGVVTCIQCQRLIFHCMTVLLLTREFKNDHANTAFWTGKWYSTGLGYM
AWTQPTRELTAKVIELSEFAADFVLGHVILIFQLPVICIPKIDKFHSIMLFWLKPSRQIR
PPIYSLKQARLRKRMVRRYCSLYFLVLIIFAGCIVGPAVASAHVPKDLGSGLTGTFHNLV
QPRNVSNNDTGSQMSTYKSHYYTHTPSLKTWSTIK
NT seq 5688 nt NT seq  +upstreamnt  +downstreamnt
atgtcctacaacgatccaaacttgaatggacagtattacagtaacggtgatgggactggt
gacggtaattaccctacgtaccaagtgacacaggatcaaagtgcgtacgatgagtacggt
cagccaatctatacacaaaaccaactggatgatggttattatgatccaaacgaacaatac
gttgacggtacacaatttcctcagggacaagatccttcacaagaccaaggtccttataat
aacgatgctagttactataaccaaccccccaatatgatgaacccgtcttctcaagatgga
gagaacttctcagattttagcagctatggtcccccatccggcacttatcctaacgatcaa
tatactccttctcaaatgagttatcctgatcaagatggttcttcaggggcctcaaccccc
tatggaaatggtgtcgttaatggtaatggccagtactacgaccctaatgctattgaaatg
gctttaccaaatgatccatatcccgcatggaccgcagatccccagtctcccctgcccatc
gaacaaatcgaagatatcttcatagatttaacaaataaattcggttttcagagagattcc
atgagaaatatgtttgaccattttatgacccttttggactctagatcttctaggatgtct
ccagaacaggcccttttatcattacatgcagactacataggtggagatacggccaactac
aaaaaatggtactttgccgctcaacttgatatggatgatgaaattggtttcaggaatatg
aagttgggtaagctatcaagaaaggcaagaaaggctaagaagaaaaataaaaaagccatg
caagaggctagtcctgaagacactgaggagactttaaatcaaattgagggtgataactca
ttagaagctgcggattttagatggaagtcaaagatgaatcaactttctccatttgaaatg
gttcgtcaaattgccttgtttttattatgttggggcgaggcaaatcaagtcagatttacc
ccggagtgtctttgtttcatttataaatgcgcctctgattacttagattctgcacaatgt
caacaacgtcctgatcccttgcctgaaggtgattttttgaatagagttattactcctctt
tatcgttttattaggagccaggtttacgaaatcgtggatggtcgatacgtgaagagtgaa
aaagatcataacaaagttattgggtatgatgatgtcaatcaattattctggtatccagaa
ggtatagcaaaaattgtcatggaagatggaaccaggttgattgatttgccagcagaggag
cgttatttgaaattgggagaaattccctgggatgatgtcttctttaaaacttacaaagaa
acacgttcctggttacatttagttaccaacttcaatcgtatttggatcatgcacatctca
gtatattggatgtattgtgcttacaatgctccaactttttatactcacaactatcaacaa
ttggtcgacaatcagcctttggcagcttataaatgggccactgcagcattaggtggtact
gtggcaagtttgattcaagttgccgctactttgtgcgagtggtcattcgttcctagaaaa
tgggcgggtgctcaacatttgtcccgtagattctggttcttgtgtgtcattatgggtatt
aatttggggcctgtgatatttgttttcgcttatgataaggacacagtatattctactgcc
gctcatgtcgttggagcagttatgttttttgttgctgtggcaacacttgttttcttttcc
gtaatgccattgggtggattatttacatcgtatatgaaaaagtccacaagaagttatgtt
gcctcacagaccttcaccgcatcttttgctccattgcatggtttagacaggtggatgtct
tatttggtttgggtaaccgtttttgctgctaaatatgcagagtcatatttttttctaata
ctgtcactaagagatccaattaggattttatctactacatcaatgagatgtactggtgaa
tactggtggggtaataagatttgtaaggtccagccaaagattgttttaggtttaatgatt
gcgactgacttcattttgttctttttggatacctacttgtggtatatcgttgttaacact
gttttctcggtcggaaaatcgttctatttgggtatttctatcttaactccatggagaaat
attttcactagattgccaaaaagaatttattctaagatcttggctactactgatatggaa
ataaaatataaaccgaaagtactaatttctcagatttggaatgctatcattatctccatg
tacagagaacatttattagccatagaccatgtacaaaaattgttatatcatcaggttccg
tccgaaattgaaggtaagaggactttgagagcaccaactttctttgtttcccaagatgac
aataattttgagactgaatttttccctagagattcagaagctgagcgccgtatttcattt
tttgcccaatctctatccactccaattccagaaccactaccagttgacaacatgccaaca
tttactgtattaactccccattacgccgagaggattctattatcattgagagaaattatt
cgtgaagatgatcaattttcaagagttactcttttggaatacctgaagcaattacacccg
gtagaatgggactgttttgttaaggatacgaaaattcttgctgaagaaacggccgcatat
gaaaacaatgaagatgaacctgaaaaggaagacgctctgaaatctcaaattgatgattta
cctttctattgtattggtttcaaatctgctgcaccagaatacaccttacgtacgagaatc
tgggcctctttaaggtcgcaaactttgtatcgcacaatctcggggtttatgaattattcg
agggccataaaattactttatcgtgtggaaaatccagaaatcgttcaaatgttcggtggt
aatgctgatggattagaaagagaactggaaaaaatggcaaggcgaaaattcaaattcttg
gtttcgatgcaaagattggccaagtttaaaccacatgaactagaaaatgctgagttcctg
ttgagagcttatccggacttgcaaattgcctacctggatgaagaacctcccttaaacgaa
ggcgaagagccaagaatttactcggccttaattgatggtcattgtgagattttagagaat
ggtcgtagacgtcccaaatttagagttcaactatccggtaatccaattcttggtgatggt
aaatcagataatcaaaatcatgctttgattttttacagaggtgagtatattcaattgatt
gatgctaatcaagacaattacttggaagagtgtttgaaaatcaggtctgtcttagcagaa
tttgaagaattgggaattgagcaaattcatccttatactcctggtttaaaatatgaggac
caatccacaaatcatcctgttgcaattgtcggcgctagagaatatattttctcagaaaac
tctggtgttcttggtgatgtagcggctggtaaagaacaaacttttggtacattatttgcc
cgtactttggcacagattggtggtaaattgcattatggtcatccagattttattaatgcg
acattcatgactactaggggtggtgtttccaaagcacaaaagggtctacatttaaatgaa
gatatttatgccggtatgaatgccgtacttcggggtggtcgtatcaagcattgcgaatat
tatcagtgtggtaaaggtagagatttaggttttggtacaattttgaatttcactactaag
atcggtgctggtatgggtgaacaaatgttatctcgtgaatactattatttgggtacgcaa
ttacctattgaccgttttttaacattttattatgcgcatccagggtttcacttgaataac
ttatttattcaattgtctctgcagatgttcatgttaactttagtgaacttgcatgctttg
gctcatgaatccattctgtgtgtttacgatagggataagccaattactgatgttttgtat
ccaattggttgttacaactttcatcctgcgattgattgggtgagacgttatacactctct
attttcatcgtcttttggattgcttttgtccctattgtcgttcaggaattaatcgagcgt
ggtctgtggaaggcgacacaaagatttttccgtcacattttatctctatctccaatgttt
gaagtctttgctggccaaatctattcttcagcactgttaagtgatatcgctgtgggtggt
gctcgttatatttcaacaggtcgtggctttgctacatctcgtatacctttctctattctt
tattcaagatttgcgggttcagccatttatatgggatcaagatcaatgttgatgttatta
tttggtaccgtggcacattggcaagctccactattatggttttgggcatcattatcagcc
ttaatctttgcaccattcattttcaatccacatcaatttgcttgggaagattttttccta
gactacagagattatatcagatggctgtcaagaggtaataataagtaccacaggaactca
tggattggttatgtaagaatgtcgaggtctcgtgttactggtttcaagcgcaaactggtg
ggtgatgagtctgaaaaatctgcaggcgatgcaagcagggctcatagaaccaatttaatt
atggctgaaattataccgtgtgcgatttacgcagcaggttgttttattgccttcacgttt
attaatgcacaaactggtgtcaagactactgatgaagatagagtaaattccaccttacgt
atcatcatttgcaccttggcgcctattgttatcgatattggtgttttattcttctgtatg
ggtttgtcatgctgctctggccctttgttgggcatgtgctgcaagaaaactggttctgtt
atggcagggatcgctcacggtatcgctgttgttgtccatattgtctttttcattgtcatg
tgggttttagagggttttagttttgttaggatgttgattggcgttgttacatgtatacaa
tgtcaaaggttgatttttcactgtatgactgtactgttgctgacccgtgagttcaagaat
gatcacgctaatactgccttttggacaggcaaatggtacagcaccggtttaggatatatg
gcatggactcaaccgacaagggaattgactgcaaaagtcattgagctttccgagtttgca
gcggattttgttttggggcatgtaattttgatcttccaactaccagtcatttgtattcca
aagatagataagtttcactccatcatgttattttggttaaaaccatcccgtcaaatccgt
cctcctatttactctttgaaacaagcacgcctacgtaaacgtatggttaggaggtattgc
agcttgtactttttggtactgatcatattcgcgggatgcatcgttggccctgccgttgct
tcagcacatgttccaaaagaccttggatctgggttgacgggtactttccataacttggtt
caaccaaggaacgtatctaacaatgatacagggtcccagatgtctacttataagagtcat
tattacactcatacgccatccttaaagacctggtctacgatcaaatga

DBGET integrated database retrieval system