KEGG   Saccharomyces cerevisiae (budding yeast): YGR040WHelp
Entry
YGR040W           CDS       T00005                                 

Gene name
KSS1
Definition
(RefSeq) mitogen-activated serine/threonine-protein kinase KSS1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04011  MAPK signaling pathway - yeast
sce04111  Cell cycle - yeast
sce04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:sce00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04011 MAPK signaling pathway - yeast
    YGR040W (KSS1)
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    YGR040W (KSS1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    YGR040W (KSS1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sce01001]
    YGR040W (KSS1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sce03036]
    YGR040W (KSS1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sce04147]
    YGR040W (KSS1)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     YGR040W (KSS1)
Protein kinases [BR:sce01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   YGR040W (KSS1)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     YGR040W (KSS1)
Exosome [BR:sce04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   YGR040W (KSS1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Kdo APH FTA2
Motif
Other DBs
NCBI-GeneID: 852931
NCBI-ProteinID: NP_011554
SGD: S000003272
UniProt: P14681
Position
VII:575398..576504
Genome map
AA seq 368 aa AA seqDB search
MARTITFDIPSQYKLVDLIGEGAYGTVCSAIHKPSGIKVAIKKIQPFSKKLFVTRTIREI
KLLRYFHEHENIISILDKVRPVSIDKLNAVYLVEELMETDLQKVINNQNSGFSTLSDDHV
QYFTYQILRALKSIHSAQVIHRDIKPSNLLLNSNCDLKVCDFGLARCLASSSDSRETLVG
FMTEYVATRWYRAPEIMLTFQEYTTAMDIWSCGCILAEMVSGKPLFPGRDYHHQLWLILE
VLGTPSFEDFNQIKSKRAKEYIANLPMRPPLPWETVWSKTDLNPDMIDLLDKMLQFNPDK
RISAAEALRHPYLAMYHDPSDEPEYPPLNLDDEFWKLDNKIMRPEEEEEVPIEMLKDMLY
DELMKTME
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atggctagaaccataacttttgatatcccttcccaatataaactcgtagatttaataggt
gagggagcgtacggaacagtatgttcagcaattcataagccttccggcataaaggtagct
atcaagaaaatacaaccgtttagcaaaaaattgtttgttacaagaactatacgtgagatc
aagcttttacggtatttccatgaacacgaaaacataataagtatattggataaagtaagg
ccagtatccatagacaaactaaacgctgtttatttagtcgaagagttgatggaaaccgat
ttacaaaaagtaattaataatcagaatagcgggttttccactttaagtgatgaccatgtt
caatactttacataccaaatcctcagagccttaaagtctattcacagtgcacaagttatc
catagagacataaagccatcaaacctgttactaaattccaattgtgatctcaaagtctgc
gattttggactagcgaggtgtttagctagcagtagcgattcaagagaaacattggtagga
ttcatgacggagtacgtcgcaacgcgatggtacagggcacccgagataatgctaactttt
caagagtacacaactgcgatggatatatggtcatgcggatgcattttggctgaaatggtc
tccgggaagcctttgttcccaggcagagactatcatcatcaattatggctaattctagaa
gtcttgggaactccatctttcgaagactttaatcagatcaaatccaagagggctaaagag
tatatagcaaacttacctatgaggccacccttgccatgggagaccgtctggtcaaagacc
gatctgaatccagatatgatagatttactagacaaaatgcttcaattcaatcctgacaaa
agaataagcgcagcagaagctttaagacacccttacctggcaatgtaccatgacccaagt
gatgagccggaatatcctccacttaatttggatgatgaattttggaaactggataacaag
ataatgcgtccggaagaggaggaagaagtgcccatagaaatgctcaaagacatgctttac
gatgaactaatgaagaccatggaatag

DBGET integrated database retrieval system