KEGG   Saccharomyces cerevisiae (budding yeast): YGR055W
Entry
YGR055W           CDS       T00005                                 

Symbol
MUP1
Name
(RefSeq) Mup1p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB
Motif
Pfam: AA_permease_2 AA_permease
Other DBs
NCBI-GeneID: 852946
NCBI-ProteinID: NP_011569
SGD: S000003287
UniProt: P50276
Position
VII:599417..601141
AA seq 574 aa
MSEGRTFLSQLNVFNKENYQFSSSTTKKEVSNSTVDADNGASDFEAGQQFATELDQGEKQ
LGILSCIGLICNRMLGTGVFAVSSTIYTLCGSVGLALIMWAVGAIIAISGLYVYMEFGTA
IPKNGGEKNYLEAIFRKPKFFITCMYAAYIFFLGWAAGNSINTAIMFLTAADTEVTKWNQ
RGIGVAVVFFAFLINSLNVKIGLYLQNILGIFKIGIVLFISITGWVALGGGLKDGYQSHN
FRNAFEGTETATAYGIVNALYSVIWSFVGYSNVNYALGEVKNPVRTLKIAGPTSMVFLAI
IYIFVNIAYFAVVPKDKLISSKLILAADFFDIVFGGQAKRAAAALVGLSALGNVLSVIFS
QGRIIQQLGREGVLPFSNFFASSKPFNSPMVGLFQHFIVCTVTILAPPPGDAYLLVQNLI
SYPMNIINFAISAGLLWIYWQRRQGKIEWNPPIKAGVFVTGFFTLSNLYLIIAPYVPPSN
GESVYSSMPYWIHCVIAWGIFFFGGVYYVVWAQLLPRWGHYKLVSKDVLGEDGFWRVKIA
KVYDDTIGDVDTQEDGVIETNIIEHYKSEQEKSL
NT seq 1725 nt   +upstreamnt  +downstreamnt
atgtcggaaggaagaacgtttctgtcacagttgaatgtcttcaacaaggagaactatcaa
ttttcttcttctactacaaaaaaggaagtaagtaactcgacagtggatgctgacaacggt
gcctccgattttgaggcaggccagcaatttgctacagaattggaccaaggtgaaaagcag
ttaggtattttgtcgtgtattgggcttatctgtaatagaatgcttggtaccggtgttttc
gccgtttcctcgaccatttacacactatgtgggtctgtggggcttgcattaattatgtgg
gcagttggcgccattattgccatttctgggttatatgtatacatggaattcggtacggct
ataccgaaaaatggtggtgaaaaaaactacctggaggctattttcaggaaaccaaaattc
ttcattacctgtatgtatgctgcgtatattttcttcctaggttgggctgctggtaattcc
atcaatacagctattatgtttttaactgctgctgatactgaagtgaccaaatggaatcaa
agaggtattggtgtggccgtcgttttttttgcattcctaattaattctctgaatgtcaag
attggtctatatttgcaaaacattttaggtattttcaagattggtattgtcctcttcatt
tctattaccggttgggttgcccttggcggtggtctcaaagatggttatcaatctcacaac
tttcgtaatgcttttgaaggtactgaaaccgccactgcttatggtattgttaacgcctta
tatagtgttatttggtcgtttgtcggttactccaatgttaactatgcacttggtgaagtt
aagaaccctgtgagaactttgaagattgctggtcctacatcgatggtcttcttggctata
atctacatttttgtgaacattgcttacttcgctgtggttccaaaagataagttaatttct
tcaaaattgattttagctgctgacttcttcgatattgtgtttggcggccaagccaagaga
gcagcagccgcactggtcgggttgagtgccttaggaaatgttctttctgtcattttttct
cagggtagaattattcaacaactaggacgtgaaggtgtgttgcccttttctaatttcttt
gcctcttctaagccattcaactccccaatggttggtttgtttcaacattttattgtttgt
acagtaaccattttagccccacctccaggtgatgcatatttgctagtccaaaatttaatt
tcctacccaatgaatattattaattttgccattagcgcgggtttgctttggatatactgg
caacgtagacaaggtaaaattgaatggaacccaccaattaaggccggtgtttttgttacg
ggatttttcacattatccaatttatacctgattattgctccttacgttccaccttcaaat
ggcgagtcggtgtattcaagcatgccatactggatccactgtgtaattgcttggggtatt
ttcttctttggtggtgtttactacgttgtttgggcccaattattgccaagatggggccac
tacaaattggtttccaaggatgtgcttggtgaagatgggttctggagagtcaaaattgcc
aaagtttatgatgacactattggcgatgtcgatacacaagaagacggcgttattgaaacg
aatataatcgaacattacaaaagtgaacaagaaaaatcgctgtaa

DBGET integrated database retrieval system