KEGG   Saccharomyces cerevisiae (budding yeast): YGR065C
Entry
YGR065C           CDS       T00005                                 
Symbol
VHT1
Name
(RefSeq) Vht1p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB
Motif
Pfam: MFS_1
Other DBs
NCBI-GeneID: 852956
NCBI-ProteinID: NP_011579
SGD: S000003297
UniProt: P53241
Position
VII:complement(618077..619858)
AA seq 593 aa
MTISNKSWRSYFPHLRKLPEDDQYLYSDDTNSSIIAEEELHHSVDKSSKTDVTAETTAVE
PHPHNLRHDLPYEVRDEAGRKWWKYFDEFEYRVNKEYKKSRKWYEFLYPNHTTQTKAERR
LLYKLDIIIALYFFMLCWSKSVDLNNYTNAYVSNMKEDLNMKGNDYVYTSTIANVGAIVF
QLPFMYLLPRFPSHIILPVMDLGWTWFTFACYRANSLAELRAYRFILSAFGAAYYPVSQY
ILGCWYAPDEINSRVCLFFCGQQLGSVTSGLLQSRIFKSLNGVHGLAGWRWMFLIDAIAI
SLPTAIIGFFVIPGVPSKCYSLFLTDEEIRIARARNKRNQIKDGVDKSKLAPLWSRKLWK
KVFCTPAFWVLVVFDTCSWNNMTAYSGSYTLWLKSNTKYSIAQVNNLSVIPACLGFAYVI
FCAFGADLFRCKWIFMVFAAIMNTVSCALLIKWDIPSKAKWYAFFTTYFSVAASPCLWSF
INDFLRFDPQVKAITWIAIYSFSQSTYAWIPTLAWPTVESPRFKTGYTVSLIFGAIYGLW
TFVVLFFYKRNEKKHALGNGIILYDSNKGEELPEFVKKNMEERDGYYYLKRSS
NT seq 1782 nt   +upstreamnt  +downstreamnt
atgacaatttcgaataaatcgtggaggagctacttcccacatttgagaaaactacccgaa
gatgatcagtacttatactcagacgatactaactccagtatcatagctgaagaggagcta
catcatagcgtagataagtcctcgaagacagacgttacggcagaaactacagctgtagaa
cctcatcctcacaatttaaggcatgacttgccatatgaagtgagagatgaagctgggcgt
aaatggtggaaatattttgatgaattcgagtatcgtgttaataaggaatacaagaaatca
cgtaagtggtacgagtttttgtatcctaatcatactactcaaaccaaggctgaaagacgg
cttctttacaagctagacattattattgctttatacttttttatgttatgttggtccaag
tcagtggatttgaataactacactaacgcatatgtttccaatatgaaggaagatttaaac
atgaaaggtaatgattacgtttacacttctactattgctaatgttggtgccattgtcttc
caattaccatttatgtatttgttaccaagatttccctctcatattattttgcctgtaatg
gacttgggctggacttggttcacatttgcatgttatagggcaaactcactagccgaacta
agggcttacagatttattttaagtgcctttggcgctgcttactacccagtgtcccaatat
atactaggttgttggtatgccccagatgaaattaattcaagagtctgtttattcttttgt
gggcaacaattgggttccgtgacttcaggacttctgcaaagtcgcatattcaaaagtttg
aacggcgtccatggtctagcaggctggagatggatgtttctgatcgatgccattgcaatt
tctcttcccacggctattattggtttttttgttattcccggtgtaccatctaagtgttac
tctttatttctgactgacgaagaaatacgaattgcaagggccagaaataagaggaaccaa
atcaaagatggtgttgataaaagtaagctagccccattatggagcagaaaactttggaag
aaagtattttgtactccagcattctgggtacttgttgtttttgatacatgttcgtggaat
aacatgactgcgtatagtggttcatatactttgtggttaaagtctaatacaaagtactcc
attgcccaagtgaacaacctgagtgttatacccgcatgtttaggatttgcgtatgtgatt
ttttgtgcctttggtgccgatttatttagatgtaagtggatattcatggtttttgctgct
ataatgaataccgtttcttgtgccttacttatcaagtgggatattccttcgaaagctaaa
tggtacgctttcttcaccacgtatttcagtgtggccgcatcgccttgtctatggtcgttt
attaatgacttcttaaggtttgatcctcaggtgaaggctattacatggatcgccatttat
tccttctctcaatccacttacgcctggattcctaccttggcgtggcctaccgtggagtca
ccacgttttaagactggttacaccgtgagcttaatttttggtgctatttacggtttatgg
acgtttgttgtactttttttttacaagagaaacgaaaagaaacatgctctaggtaatggt
atcatcttgtatgatagtaataagggtgaagagcttccagaatttgtaaagaaaaatatg
gaggaaagagatggttactactatttaaagcggtcctcgtag

DBGET integrated database retrieval system