KEGG   Saccharomyces cerevisiae (budding yeast): YGR090WHelp
Entry
YGR090W           CDS       T00005                                 

Gene name
UTP22
Definition
(RefSeq) rRNA-processing protein UTP22
  KO
K14544  U3 small nucleolar RNA-associated protein 22
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    YGR090W (UTP22)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:sce03009]
    YGR090W (UTP22)
Ribosome biogenesis [BR:sce03009]
 Eukaryotic Type
  90S particles
   U3 small nucleolar RNA-associated proteins
    YGR090W (UTP22)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Nrap_D5 Nrap_D4 Nrap_D2 Nrap Nrap_D3 Nrap_D6
Motif
Other DBs
NCBI-GeneID: 852982
NCBI-ProteinID: NP_011604
SGD: S000003322
UniProt: P53254
Structure
PDB: 

Position
VII:662358..666071
Genome map
AA seq 1237 aa AA seqDB search
MATSVKRKASETSDQNIVKVQKKHSTQDSTTDNGSKENDHSSQAINERTVPEQENDESDT
SPESNEVATNTAATRHNGKVTATESYDIHIARETAELFKSNIFKLQIDELLEQVKLKQKH
VLKVEKFLHKLYDILQEIPDWEEKSLAEVDSFFKNKIVSVPFVDPKPIPQNTNYKFNYKK
PDISLIGSFALKAGIYQPNGSSIDTLLTMPKELFEKKDFLNFRCLHKRSVYLAYLTHHLL
ILLKKDKLDSFLQLEYSYFDNDPLLPILRISCSKPTGDSLSDYNFYKTRFSINLLIGFPY
KVFEPKKLLPNRNCIRIAQESKEQSLPATPLYNFSVLSSSTHENYLKYLYKTKKQTESFV
EATVLGRLWLQQRGFSSNMSHSGSLGGFGTFEFTILMAALLNGGGINSNKILLHGFSSYQ
LFKGVIKYLATMDLCHDGHLQFHSNPENSSSSPASKYIDEGFQTPTLFDKSTKVNILTKM
TVSSYQILKEYAGETLRMLNNVVQDQFSNIFLTNISRFDNLKYDLCYDVQLPLGKYNNLE
TSLAATFGSMERVKFITLENFLAHKITNVARYALGDRIKYIQIEMVGQKSDFPITKRKVY
SNTGGNHFNFDFVRVKLIVNPSECDKLVTKGPAHSETMSTEAAVFKNFWGIKSSLRRFKD
GSITHCCVWSTSSSEPIISSIVNFALQKHVSKKAQISNETIKKFHNFLPLPNLPSSAKTS
VLNLSSFFNLKKSFDDLYKIIFQMKLPLSVKSILPVGSAFRYTSLCQPVPFAYSDPDFFQ
DVILEFETSPKWPDEITSLEKAKTAFLLKIQEELSANSSTYRSFFSRDESIPYNLEIVTL
NILTPEGYGFKFRVLTERDEILYLRAIANARNELKPELEATFLKFTAKYLASVRHTRTLE
NISHSYQFYSPVVRLFKRWLDTHLLLGHITDELAELIAIKPFVDPAPYFIPGSLENGFLK
VLKFISQWNWKDDPLILDLVKPEDDIRDTFETSIGAGSELDSKTMKKLSERLTLAQYKGI
QMNFTNLRNSDPNGTHLQFFVASKNDPSGILYSSGIPLPIATRLTALAKVAVNLLQTHGL
NQQTINLLFTPGLKDYDFVVDLRTPIGLKSSCGILSATEFKNITNDQAPSNFPENLNDLS
EKMDPTYQLVKYLNLKYKNSLILSSRKYIGVNGGEKGDKNVITGLIKPLFKGAHKFRVNL
DCNVKPVDDENVILNKEAIFHEIAAFGNDMVINFETD
NT seq 3714 nt NT seq  +upstreamnt  +downstreamnt
atggctacaagtgttaaaagaaaagcatctgagacttctgaccagaatattgttaaagtg
caaaagaaacattccacacaggacagcacaactgacaacggatccaaagaaaatgatcac
agtagtcaagccatcaacgagcgtaccgtgcccgagcaagaaaacgacgaaagcgatact
tcacctgaaagtaacgaggtcgctactaacactgctgcgactcgccacaatggaaaggtt
actgcaacagagtcctatgatattcacatagctagagaaacggctgaattattcaagtct
aatattttcaagttacaaattgacgaattactggagcaagtgaagttaaaacaaaaacat
gttctgaaagtcgaaaaatttctacacaagttatatgatattctccaggaaattcctgat
tgggaggaaaagtcattagctgaagtggactccttcttcaaaaacaagattgtttctgtt
ccatttgttgaccccaaacctattcctcaaaatactaattataaattcaattacaagaaa
ccagacatctccttaattggctcctttgctcttaaagctggaatttatcaacctaacggc
tcttccattgatactttactaacaatgccaaaggagttgttcgaaaaaaaagatttctta
aatttcaggtgcttacacaagaggagcgtttatttagcatacctaacccaccacctattg
atattattgaaaaaagataaattagactcatttttgcaactcgagtattcttattttgat
aatgatccgcttttaccaattttaagaattagttgttccaaaccaacgggtgattctctt
tctgattataacttttacaagaccagattctctatcaacttgcttattggtttcccatac
aaagtctttgaaccaaaaaaactgttacccaatagaaactgtattagaatagcacaagaa
agcaaagagcaatctttaccagccactcctctttacaatttttcagtgttatcttcttca
acacatgaaaactacctgaagtatttatacaagacgaagaaacaaacagaatcttttgtt
gaagctactgttttaggtagattatggctgcagcaacgtgggttttcatccaatatgtcg
cattctggttcattgggtggattcggtacttttgaatttactatcttgatggcagcgtta
ttaaacggtggtggtataaatagtaacaagatattacttcacgggttttcatcataccaa
ttgtttaaaggtgtaataaaatacttagccactatggatttgtgccacgacggccattta
caatttcattctaatccagagaattcctccagttcaccagcttctaaatatattgatgag
ggtttccaaactccaaccttatttgataagtcaaccaaggtcaatattcttacaaaaatg
actgtttcttcttatcaaattttgaaagaatatgccggtgaaacattgagaatgctaaac
aacgttgttcaagaccaattctcaaatatttttttgactaatattagccgttttgacaat
ttgaagtacgatctgtgttacgatgtacagttacctttgggtaagtacaataatttagaa
acttctttagctgctacatttgggtcaatggaaagagtaaaatttattactctggagaat
ttcctcgcccacaagattacaaatgttgcaaggtatgcattgggcgatagaatcaaatat
atccaaattgaaatggttggtcaaaagtccgattttccaatcaccaaaagaaaagtgtac
tctaacacaggaggtaaccatttcaactttgattttgtaagagtaaaattgattgttaac
ccctctgaatgtgacaaattagtcaccaagggccctgctcattctgaaactatgtctaca
gaagcagccgtttttaagaatttttggggaattaaatcttccttaagaagattcaaggat
ggctccatcacccattgttgtgtttggtctacatcctcatcagagcccatcatttcctca
attgttaactttgcattgcagaaacatgtttcaaaaaaggcacaaatatcaaatgagact
atcaagaagtttcataatttcctaccgttgccaaacttaccctcaagtgctaaaacatca
gttttgaacttgagcagctttttcaacttaaagaaatcctttgacgatttatacaaaata
attttccaaatgaagttaccgctttctgtaaaatcaatcttaccggttggctctgcattt
agatacacttccttatgccaaccagtaccattcgcatactctgatccagatttctttcaa
gacgtcattttggaatttgaaacctcacctaaatggccagatgaaattacttccttagaa
aaggctaaaacagcttttcttctcaaaattcaagaagaattaagcgctaactcttcaact
tataggtcgtttttcagcagagatgaatccatcccatacaatttagaaattgtaaccttg
aacatcttgacacctgaaggttatggattcaaattcagagttctaactgaacgtgacgaa
atcctttatttaagagctatagcgaatgctaggaatgagttgaaaccagaattggaggcc
acattcctaaaatttactgcaaaatatctggcttccgtaagacatactcgtactttggag
aatatatctcattcgtatcaattctactcccctgtggtaagactattcaaaagatggttg
gacactcatttattactaggtcatataacggacgaattagcagagttgattgccattaaa
ccttttgttgatcctgcaccatatttcattccaggttctcttgaaaacggtttcctcaaa
gtgcttaagtttataagtcaatggaactggaaagatgatccattgattttagatctagta
aaaccagaagatgatataagagatacatttgaaacaagtattggagctggctcagagcta
gactccaaaacgatgaaaaagctttctgaaagattaaccctagcacaatataagggcatt
caaatgaacttcacgaacttgaggaacagtgatcccaacggtacacatttgcaatttttt
gttgcctctaagaacgatccaagcggtattctttattcatcaggtatcccactacccatt
gctacaaggcttacagcattagctaaagtagccgtgaatcttttacagacacacggttta
aaccagcaaactatcaatcttttattcacgcctggattaaaagattacgattttgtcgtt
gatttgaggacaccaataggtttgaaatcatcctgtggtatactttcagccacagagttc
aagaatataactaacgatcaagccccatcgaactttccagagaatttgaatgatttaagt
gaaaaaatggatccaacataccagttagtgaagtatttgaacttgaagtacaagaatagt
ttgattttatcaagccgcaagtatataggtgtgaatggtggagagaaaggagataaaaat
gtcatcacagggctaataaagccactcttcaagggagcccacaaatttagagtaaacttg
gattgcaacgttaaaccagtggatgatgagaatgtgattttaaataaagaagccatattt
catgagattgctgcattcgggaatgacatggttataaattttgagacagattag

DBGET integrated database retrieval system