KEGG   Saccharomyces cerevisiae (budding yeast): YGR091WHelp
Entry
YGR091W           CDS       T00005                                 

Gene name
PRP31
Definition
(RefSeq) U4/U6-U5 snRNP complex subunit PRP31
  KO
K12844  U4/U6 small nuclear ribonucleoprotein PRP31
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    YGR091W (PRP31)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:sce03041]
    YGR091W (PRP31)
Spliceosome [BR:sce03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   U4/U6 snRNP specific factors
    YGR091W (PRP31)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Nop Prp31_C
Motif
Other DBs
NCBI-GeneID: 852983
NCBI-ProteinID: NP_011605
SGD: S000003323
UniProt: P49704
Structure
PDB: 

Position
VII:666341..667825
Genome map
AA seq 494 aa AA seqDB search
MSSEEDYFDELEYDLADEVNEEKEDIQTKKLTTVNCQTEKFNPFEILPESIELFRTLALI
SPDRLSLSETAQILPKIVDLKRILQQQEIDFIKLLPFFNEIIPLIKSNIKLMHNFLISLY
SRRFPELSSLIPSPLQYSKVISILENENYSKNESDELFFHLENKAKLTREQILVLTMSMK
TSFKNKEPLDIKTRTQILEANSILENLWKLQEDIGQYIASKISIIAPNVCFLVGPEIAAQ
LIAHAGGVLEFSRIPSCNIASIGKNKHLSHELHTLESGVRQEGYLFASDMIQKFPVSVHK
QMLRMLCAKVSLAARVDAGQKNGDRNTVLAHKWKAELSKKARKLSEAPSISETKALPIPE
DQPKKKRAGRKFRKYKEKFRLSHVRQLQNRMEFGKQEQTVLDSYGEEVGLGMSNTSLQQA
VGATSGSRRSAGNQAKLTKVMKHRISEANQQADEFLISLGHNTEQPNLSPEMVQMHKKQH
TNPEEETNWFSGHG
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgagctctgaagaggactatttcgatgagctcgaatatgaccttgccgatgaagttaat
gaggaaaaagaagacatacaaactaaaaagctcactacggtaaattgtcaaacagaaaaa
ttcaatccattcgaaattcttccggaaagtatagaattattcaggacgttggcactcatc
agtcctgataggttatctctatcagagacagcacagattttaccaaaaattgtcgattta
aaaagaatccttcaacaacaagaaatagatttcattaaactgttaccgttttttaacgaa
atcatccccctcatcaagagcaatataaaattaatgcacaattttctaatctcactgtac
agtagacgttttccagaactatcttcattgataccatcaccattacaatactcaaaagtg
ataagcatactggaaaatgaaaattattcaaaaaacgaaagtgatgaactatttttccac
ttggaaaataaagcaaaattgaccagagagcagatcctcgttttaacaatgtccatgaag
acgtctttcaaaaacaaagagccattggacatcaaaacgaggacgcaaattttagaagca
aatagcatattggaaaatttatggaaactacaagaagatataggtcaatacatagcctca
aagatatcaataattgcccctaacgtgtgtttcttggtaggcccggagatagcagcccaa
ttaatagcacatgctggaggggttttggagttcagtcgcattcccagttgcaacattgcg
tccattgggaagaataagcacctctcacatgagttacatacattagagagtggagtacga
caagaaggatatctatttgcttctgacatgattcagaaatttcccgtttctgtccataaa
caaatgcttaggatgctttgtgcaaaagtatcactagccgcaagagttgatgctggccag
aaaaacggtgatagaaatacagttttagctcataaatggaaagccgaactatcgaagaaa
gctagaaagctatcagaagccccgagcatttctgaaacgaaggctctacctattccggag
gaccaacccaaaaagaaaagagctgggagaaaatttaggaagtacaaggaaaaattcaga
ctatcgcatgtcagacaattacaaaataggatggaatttggcaagcaagaacaaactgtt
cttgattcctatggtgaagaagttggtttgggtatgtctaatacttctttacaacaagca
gtaggagctacatcaggttccagaagatctgctggtaatcaagccaagctaacaaaggta
atgaagcacaggatttctgaggctaatcagcaagctgacgaattcctaatctccttgggt
cataatacagagcaaccgaatctgtcgccagagatggttcaaatgcacaagaaacagcat
actaacccagaagaagagaccaattggttttccggtcatggttag

DBGET integrated database retrieval system