KEGG   Saccharomyces cerevisiae (budding yeast): YGR092WHelp
Entry
YGR092W           CDS       T00005                                 

Gene name
DBF2
Definition
(RefSeq) serine/threonine-protein kinase DBF2
  KO
K06684  cell cycle protein kinase DBF2 [EC:2.7.11.-]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04111  Cell cycle - yeast
sce04392  Hippo signaling pathway - multiple species
Brite
KEGG Orthology (KO) [BR:sce00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04392 Hippo signaling pathway - multiple species
    YGR092W (DBF2)
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    YGR092W (DBF2)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.-  
     YGR092W (DBF2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_C Haspin_kinase Kdo Kinase-like APH
Motif
Other DBs
NCBI-GeneID: 852984
NCBI-ProteinID: NP_011606
SGD: S000003324
UniProt: P22204
Structure
PDB: 

Position
VII:668189..669907
Genome map
AA seq 572 aa AA seqDB search
MLSKSEKNVDLLAGNMSNLSFDGHGTPGGTGLFPNQNITKRRTRPAGINDSPSPVKPSFF
PYEDTSNMDIDEVSQPDMDVSNSPKKLPPKFYERATSNKTQRVVSVCKMYFLEHYCDMFD
YVISRRQRTKQVLEYLQQQSQLPNSDQIKLNEEWSSYLQREHQVLRKRRLKPKNRDFEMI
TQVGQGGYGQVYLARKKDTKEVCALKILNKKLLFKLNETKHVLTERDILTTTRSEWLVKL
LYAFQDLQSLYLAMEFVPGGDFRTLLINTRCLKSGHARFYISEMFCAVNALHDLGYTHRD
LKPENFLIDAKGHIKLTDFGLAAGTISNERIESMKIRLEKIKDLEFPAFTEKSIEDRRKM
YNQLREKEINYANSMVGSPDYMALEVLEGKKYDFTVDYWSLGCMLFESLVGYTPFSGSST
NETYDNLRRWKQTLRRPRQSDGRAAFSDRTWDLITRLIADPINRLRSFEHVKRMSYFADI
NFSTLRSMIPPFTPQLDSETDAGYFDDFTSEADMAKYADVFKRQDKLTAMVDDSAVSSKL
VGFTFRHRNGKQGSSGILFNGLEHSDPFSTFY
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgctatcaaaatcagaaaaaaatgtcgacctcttggcaggcaatatgagcaatttgagt
ttcgatgggcatgggactcctgggggcactggactatttcctaaccaaaatataacaaag
aggaggacaaggcctgcgggtatcaatgattcaccttcgccggtaaaaccatcctttttt
ccttacgaagatacttccaacatggacatagacgaagtatctcaacctgatatggatgtc
tcgaactctcccaagaagcttccaccaaagttttacgaaagagcaacttcaaataaaaca
cagagagttgttagtgtttgcaaaatgtactttctagaacattactgtgatatgtttgac
tatgtaattagtagaagacaacgcacgaagcaagttctagaatacctgcaacagcaaagc
caacttccgaattctgaccagattaaactcaacgaagagtggtcctcttacttacaaagg
gaacatcaggttttgagaaaaagaaggttgaaaccaaaaaatagggattttgaaatgatc
acacaagtaggtcaaggtggttatgggcaagtttatttagccagaaagaaagacacaaaa
gaggtgtgtgctttgaaaattttgaacaaaaaactattgtttaagctcaacgagacaaaa
cacgttttaactgaaagagatatcctaaccacgacaaggtctgaatggttagtaaaactt
ctgtatgcattccaagacctacaaagtttatacctggctatggaatttgtaccaggcggt
gattttcgtacattattaataaatactagatgcttgaaaagtggccatgcgagattttac
atcagtgaaatgttttgcgctgttaatgcgttacatgatttaggctatacacatagagat
ttaaagccggaaaacttcttaatcgatgccaagggacatataaaattaacagattttggt
ttggctgctggtacgatttctaatgaaagaattgaaagtatgaagataaggttagaaaaa
atcaaggacctggaatttccagcgtttacagagaaatctatagaagatagaagaaaaatg
tacaaccagttgagggagaaggaaattaattatgcgaactccatggttgggtctccggat
tatatggctttggaggttttagaaggaaagaaatatgactttactgtggattactggtcg
ttgggttgtatgctgttcgaaagtttagttggttatacaccatttagtggatcatcgact
aatgagacctatgacaacttaaggcgctggaaacaaactttaagaagaccgagacaatct
gatgggagggcagcattctccgatagaacttgggatttaataacaagattgattgccgat
ccaatcaatcgattaagatccttcgaacatgttaaacgcatgtcttattttgcagatata
aactttagtactttgaggtcaatgatcccgccttttacaccccaactagacagcgaaact
gatgccggttattttgatgacttcaccagtgaggctgacatggccaaatatgctgatgtt
ttcaaaagacaagacaaattaacggctatggtagatgactcggcagtatcatcaaaactt
gttgggttcactttccgacatagaaatggtaaacagggttccagtggcatcttattcaac
ggactggaacactcagaccccttttcaaccttttactag

DBGET integrated database retrieval system