KEGG   Saccharomyces cerevisiae (budding yeast): YGR095CHelp
Entry
YGR095C           CDS       T00005                                 

Gene name
RRP46
Definition
(RefSeq) exosome non-catalytic core subunit RRP46
  KO
K12590  exosome complex component RRP46
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03018  RNA degradation
Module
sce_M00391  Exosome, eukaryotes
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    YGR095C (RRP46)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sce03019]
    YGR095C (RRP46)
Messenger RNA biogenesis [BR:sce03019]
 Eukaryotic Type
  mRNA degradation factors
   3'-5' decay
    Core exosome factors
     YGR095C (RRP46)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNase_PH RNase_PH_C
Motif
Other DBs
NCBI-GeneID: 852987
NCBI-ProteinID: NP_011609
SGD: S000003327
UniProt: P53256
Structure
PDB: 

Position
VII:complement(675671..676342)
Genome map
AA seq 223 aa AA seqDB search
MSVQAEIGILDHVDGSSEFVSQDTKVICSVTGPIEPKARQELPTQLALEIIVRPAKGVAT
TREKVLEDKLRAVLTPLITRHCYPRQLCQITCQILESGEDEAEFSLRELSCCINAAFLAL
VDAGIALNSMCASIPIAIIKDTSDIIVDPTAEQLKISLSVHTLALEFVNGGKVVKNVLLL
DSNGDFNEDQLFSLLELGEQKCQELVTNIRRIIQDNISPRLVV
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtccaagcagaaatagggatattagatcatgtagatggttcatctgaattcgta
tcacaagacaccaaggttatttgttctgtaacaggccctattgaaccaaaagcaagacaa
gaactgcctacacaattagcattagaaattattgtacgtcccgcgaaaggggtggccaca
acaagagagaaggtactcgaagataaattacgggcagttctgaccccactcatcactcgt
cattgttacccaagacagctctgccagataacttgtcaaattctggaatctggtgaagat
gaagccgaattctccctgagagagctaagttgttgtataaatgcggcatttttggcttta
gttgatgcaggaattgccttaaatagtatgtgcgcaagcatccctattgcaataatcaaa
gacactagtgatatcattgtcgatcccactgccgagcaattgaagatttcgctctctgtc
cacactttagctctggagttcgtcaatggcggtaaagtcgtgaaaaacgttttattgtta
gacagcaatggtgattttaatgaagatcaattgttcagtttactggagctgggtgagcaa
aagtgtcaagaacttgtcacaaatataagaagaataatacaggacaatatatcacctcgt
ctagttgtatag

DBGET integrated database retrieval system