KEGG   Saccharomyces cerevisiae (budding yeast): YGR096W
Entry
YGR096W           CDS       T00005                                 

Gene name
TPC1
Definition
(RefSeq) thiamine transporter TPC1
  KO
K15108  solute carrier family 25 (mitochondrial thiamine pyrophosphate transporter), member 19
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sce02000]
    YGR096W (TPC1)
Transporters [BR:sce02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   YGR096W (TPC1)
SSDB
Motif
Pfam: Mito_carr Herpes_IE1
Other DBs
NCBI-GeneID: 852988
NCBI-ProteinID: NP_011610
SGD: S000003328
UniProt: P53257
Position
VII:676621..677565
AA seq 314 aa
MFKEEDSLRKGQNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVM
EVARSMIKNEGIRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLEARLHSLVVGA
FAGITSSIVSYPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITL
TASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLETIRRRM
QFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIPTTFVS
FWGYETAIHYLRMY
NT seq 945 nt   +upstreamnt  +downstreamnt
atgttcaaagaggaggactcgttaagaaaagggcaaaatgtggccgcgtggaaaactttg
ttggctggcgccgtatccgggctgcttgcccgtagcataactgctcccatggataccatt
aagatcagattgcaattgacccctgcaaatgggctgaagcccttcggaagtcaggtcatg
gaggtggccagaagcatgataaagaacgaaggcatccggtccttttggaagggtaacata
cccggttctttgctgtacgttacctatggctcagcgcagtttagttcatactcccttttt
aatagatatttaactccatttggactagaggcgcgcttacatagtcttgttgtcggagcc
tttgctggcataaccagttccatcgtttcctacccgttcgatgttttacggacccgacta
gttgccaacaaccagatgcactcaatgagcatcacgagagaagtgcgtgatatctggaaa
ctagaaggtctccccggatttttcaagggctccatcgcgtcaatgacaaccataactcta
accgcatctataatgttcggaacatacgaaacaatcaggatatactgtgacgaaaacgaa
aaaacgaccgccgcgcataaaaaatgggaactggctactttaaatcacagcgctggtacc
attggcggcgtcattgctaagatcattactttccccctcgaaacgatccgtaggcgaatg
cagttcatgaattcgaagcatctggaaaagttctcccgtcattcgtctgtatacggttct
tataaagggtacggattcgcaagaatcggtttacagattttgaaacaagaaggtgtgagt
tcgctttacagaggtattctggtggccctttccaagacaatacccaccacttttgtgagt
ttctgggggtatgaaactgccatccattatttgcggatgtactaa

DBGET integrated database retrieval system