KEGG   Saccharomyces cerevisiae (budding yeast): YGR099WHelp
Entry
YGR099W           CDS       T00005                                 

Gene name
TEL2
Definition
(RefSeq) Tel2p
  KO
K11137  telomere length regulation protein
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sce03032]
    YGR099W (TEL2)
   03400 DNA repair and recombination proteins [BR:sce03400]
    YGR099W (TEL2)
DNA replication proteins [BR:sce03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     YGR099W (TEL2)
DNA repair and recombination proteins [BR:sce03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   FA (Fanconi anemia) pathway
    Other FA pathway factors
     YGR099W (TEL2)
  Check point factors
   Triple T complex
    YGR099W (TEL2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Telomere_reg-2
Motif
Other DBs
NCBI-GeneID: 852991
NCBI-ProteinID: NP_011613
SGD: S000003331
UniProt: P53038
Structure
PDB: 

Position
VII:687899..689965
Genome map
AA seq 688 aa AA seqDB search
MVLETLKQGLDSSQIHEALIQLDSYPREPVDLDASMVLIKFVIPVYPSLPERSKVILRRL
ASKSFTFLCQIVTFSRTISGRDGLQEIRIYQEILEDIISFEPGCLTFYLKASTTSKADRD
SIKALFFGSKLFNVLANRIDMAKYLGYLRLQWKFLLESNETDPPGFLGEWLVSSFLLNPV
LAADMLLGELFLLKESYFFSFQKIISASSLIDQKRLIAKFLLPYIQVIVTLENLNDVRKI
LRRFDLDKIISLSVLFEIQSLPLKEVIVRLMSNHSSTKFVSALVSKFADFTDEEVDTKTC
ELLVLFAVHNLNHSQREEIAHDERFLNGVTKHLGSNEREARERAMFIAKLLSGGHLKYES
DFKINIPNVKFESNSDDKIIDFQSLKNPSICNTQTDVGKDKITEVSGHVQSLTLDCSDSD
DEDENDEREIVKRIVFLKDLMKEYEKTGESRKAPLIPLLKQTVKLIRQKADFQLEVGYYA
QGILSSIVCLNNEFDEPLFEQWRINALTSILVVLPEKVNGAINILFNSELSLQQRMSLLS
ALGLSARELRGLDDPTIVKPKFDFPTNRLPWDDQSHHNSRLVEVQESTSMIKKTKTVWKS
RKLGKDREKGTQNRFRKYAGLFFYPLAHGWLNGIDVGTYNQLFKSHYLTTLRIIYSCANP
VHDFESMTELMNHIISSAIEEGISLNKG
NT seq 2067 nt NT seq  +upstreamnt  +downstreamnt
atggttttagaaacgctgaaacaagggcttgacagcagtcaaatacatgaagctttaata
caactagattcctatcctcgcgaaccggtggatctagatgcctcgatggttctcataaaa
ttcgtaattccagtttatccatcactaccagaaagatcgaaggtgatattgagacggcta
gcttctaaatcgtttacatttttatgccaaattgtcaccttctcaaggacaataagtggc
cgcgatggactgcaagagatacgcatataccaagaaattttagaagacatcatcagtttt
gaaccgggatgtttgactttttatttaaaggcaagcactactagcaaagcagaccgtgat
agcattaaggcccttttctttgggagcaagttatttaatgtgttggccaaccgaattgat
atggcgaaatatttgggataccttcggcttcagtggaaatttctacttgagagtaatgaa
acagatccacctgggtttttaggggaatggttagtttcatcatttttgcttaacccagtg
ctagcggcagatatgttattaggcgaattatttttattgaaagagtcgtatttcttttct
tttcagaaaatcatatctgctagtagtctgatagatcaaaagaggctgattgctaagttt
ttattaccatatattcaagttatcgtgactttagaaaatttgaacgatgttaggaaaatt
ctgcggcggtttgatctcgataaaatcataagtctgtccgtattatttgaaatacagtcg
ctgccattgaaggaagtgatagtacgtctgatgagcaaccactcttccacgaagtttgtt
agcgctttggtaagtaaatttgctgattttacagatgaggaagtagacacaaagacatgt
gaattgcttgtactctttgcagtgcacaatctcaatcattcccagagagaggaaatagca
cacgatgagcggtttttgaatggcgtgaccaaacatttaggtagcaatgaacgtgaggca
agggagcgtgcgatgtttattgccaagcttttatcaggcggtcatctgaagtacgaaagt
gattttaaaatcaatataccgaatgtcaaattcgaaagcaatagcgatgataaaatcatt
gatttccaatctttaaaaaatccatccatatgcaatacccaaactgatgtgggtaaggat
aagattactgaggtctcgggtcatgttcaaagccttacattggactgcagtgatagcgat
gatgaagatgagaacgatgagcgggagattgttaaacgaattgtatttttaaaagattta
atgaaagaatacgaaaaaactggggaatctcgaaaagctccattgataccacttctgaag
caaacagtgaaattgatacggcaaaaggcggattttcagttagaggttggctattatgca
caaggtattctgtcaagcattgtgtgcttgaataatgaatttgatgaaccgcttttcgag
cagtggagaataaacgctctaacaagcatactggtcgtccttccagagaaggtgaatggc
gctataaatattctattcaattcagaactgtcgttacagcaaaggatgtcactattgtcg
gctctgggtctttctgcaagagagttgagagggcttgatgatcctactattgtcaagccc
aagtttgattttccaacaaatcgtttaccgtgggatgatcaaagccatcataatagtagg
cttgttgaagttcaagagtcaacaagtatgataaagaagacgaaaacagtatggaaatct
agaaaactaggcaaggatcgagaaaaaggaacgcaaaaccgctttagaaaatatgctggt
ctattcttctatccgctagcacacggttggcttaatggaattgacgtaggcacatacaat
cagctttttaagtcgcattatttaacaacactgcgtatcatatactcttgcgctaacccg
gtccacgattttgaatccatgacggagttgatgaatcatataattagttcagccatagag
gaaggaatttctctcaataaaggttag

DBGET integrated database retrieval system