KEGG   Saccharomyces cerevisiae (budding yeast): YGR109C
Entry
YGR109C           CDS       T00005                                 

Symbol
CLB6
Name
(RefSeq) B-type cyclin CLB6
  KO
K06651  S-phase entry cyclin 5/6
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04011  MAPK signaling pathway - yeast
sce04111  Cell cycle - yeast
sce04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04011 MAPK signaling pathway - yeast
    YGR109C (CLB6)
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    YGR109C (CLB6)
   04113 Meiosis - yeast
    YGR109C (CLB6)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 853003
NCBI-ProteinID: NP_011623
SGD: S000003341
UniProt: P32943
Position
VII:complement(705359..706501)
AA seq 380 aa
MNCIPSPISERKIQINNEDCIGKENAFHTIPRESSINLTPHSTNEKKVLSEVNSNKIDSL
QLPRGKLQRDSTHLEKTRKRQLSNDSTDPIEPKTVKKIKCHQWKNLDSIEMDDPFMVAEY
TDSIFSHLYEKEIQMLPTHNYLMDTQSPYHLKSSMRALLIDWLVEVHEKFHCLPETLFLA
INLLDRFLSQNVVKLNKLQLLCITCLFIACKFEEVKLPKITNFAYVTDGAATVEGIRKAE
LFVLSSLGYNISLPNPLNFIRRISKADNYCIETRNMAKFIMEYSICCNKFIHLKPSYLAA
MSMYIARKIKNENSKWDETFIHYSGGIDIESDPAFKDFISELVEDIAVPDTNLDSLRLKY
KKPKHGMVYFKVFDWCKQKR
NT seq 1143 nt   +upstreamnt  +downstreamnt
atgaattgtatccctagtccaattagtgaaaggaaaatccaaattaataatgaagattgt
ataggcaaggaaaatgctttccataccattccaagagaaagttcaattaacttgacacct
cactctacgaatgaaaaaaaagttctatccgaggtaaacagtaacaaaatcgattcttta
caactccctcgaggtaaattgcaaagagattccacccatttggaaaaaacaagaaagaga
caattatcaaatgattcaaccgatcctatagagccaaaaactgtgaaaaaaataaaatgt
catcaatggaaaaatttggattcgatagagatggatgatccattcatggtagcagaatat
acagattctatattttctcatctttacgagaaggaaatccaaatgctaccgacacataac
tatttaatggacacgcaatctccctatcatttgaaaagctccatgagggcgctgttaatt
gactggttggttgaagttcatgagaaatttcactgcttacctgaaacattatttttagcg
atcaacctgctagatcgatttttatcacaaaatgttgttaaattgaataaattacaacta
ctatgcatcacttgcctgttcattgcctgtaaatttgaagaagttaaattaccaaaaata
acaaattttgcgtacgtgactgacggtgctgccactgtcgaaggaattaggaaggctgag
ctattcgttctaagttctttaggttataacatatctctaccaaaccccctaaatttcatt
aggagaatttcaaaagctgacaattactgcattgaaacaaggaacatggccaaattcatc
atggaatattcgatttgttgtaataaattcatccacctgaagccatcatatttagctgca
atgtccatgtatatcgccagaaaaattaaaaatgaaaattccaaatgggatgaaactttt
attcattatagtggcggcattgatattgaatcagatccagcgtttaaggattttatcagt
gaactagttgaagatattgctgtacctgatacgaatctagattccttgagacttaaatac
aaaaagcctaaacatggcatggtttatttcaaggtttttgactggtgtaaacaaaaacgt
tga

DBGET integrated database retrieval system