KEGG   Saccharomyces cerevisiae (budding yeast): YGR116W
Entry
YGR116W           CDS       T00005                                 

Gene name
SPT6, CRE2, SSN20
Definition
(RefSeq) chromatin-remodeling histone chaperone SPT6
  KO
K11292  transcription elongation factor SPT6
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:sce03021]
    YGR116W (SPT6)
   03036 Chromosome and associated proteins [BR:sce03036]
    YGR116W (SPT6)
Transcription machinery [BR:sce03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription elongation factors
     YGR116W (SPT6)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histone chaperones
    Other Histone chaperones and regulators
     YGR116W (SPT6)
SSDB
Motif
Pfam: YqgF SH2_2 HHH_7 HTH_44 SPT6_acidic SH2 HHH_9 Tex_YqgF
Other DBs
NCBI-GeneID: 853011
NCBI-ProteinID: NP_011631
SGD: S000003348
UniProt: P23615
Structure
PDB: 

Position
VII:720409..724764
AA seq 1451 aa
MEETGDSKLVPRDEEEIVNDNDETKAPSEEEEGEDVFDSSEEDEDIDEDEDEARKVQEGF
IVNDDDENEDPGTSISKKRRKHKRREREEDDRLSEDDLDLLMENAGVERTKASSSSGKFK
RLKRVGDEGNAAESESDNVAASRQDSTSKLEDFFSEDEEEEESGLRNGRNNEYGRDEEDH
ENRNRTADKGGILDELDDFIEDDEFSDEDDETRQRRIQEKKLLREQSIKQPTQITGLSSD
KIDEMYDIFGDGHDYDWALEIENEELENGNDNNEAEEEEIDEETGAIKSTKKKISLQDIY
DLEDLKKNLMTEGDMKIRKTDIPERYQELRAGITDYGNMSSEDQELERNWIAEKISVDKN
FDANYDLTEFKEAIGNAIKFITKENLEVPFIYAYRRNYISSREKDGFLLTEDDLWDIVSL
DIEFHSLVNKKDYVQRFYAELHIDDPIVTEYFKNQNTASIAELNSLQDIYDYLEFKYANE
INEMFINHTGKTGKKHLKNSSYEKFKASPLYQAVSDIGISAEDVGENISSQHQIHPPVDH
PSSKPVEVIESILNANSGDLQVFTSNTKLAIDTVQKYYSLELSKNTKIREKVRSDFSKYY
LADVVLTAKGKKEIQKGSLYEDIKYAINRTPMHFRRDPDVFLKMVEAESLNLLSVKLHMS
SQAQYIEHLFQIALETTNTSDIAIEWNNFRKLAFNQAMDKIFQDISQEVKDNLTKNCQKL
VAKTVRHKFMTKLDQAPFIPNVRDPKIPKILSLTCGQGRFGADAIIAVYVNRKGDFIRDY
KIVDNPFDKTNPEKFEDTLDNIIQSCQPNAIGINGPNPKTQKFYKRLQEVLHKKQIVDSR
GHTIPIIYVEDEVAIRYQNSERAAQEFPNKPPLVKYCIALARYMHSPLLEYANLTSEEVR
SLSIHPHQNLLSSEQLSWALETAFVDIVNLVSVEVNKATDNNYYASALKYISGFGKRKAI
DFLQSLQRLNEPLLARQQLITHNILHKTIFMNSAGFLYISWNEKRQKYEDLEHDQLDSTR
IHPEDYHLATKVAADALEYDPDTIAEKEEQGTMSEFIELLREDPDRRAKLESLNLESYAE
ELEKNTGLRKLNNLNTIVLELLDGFEELRNDFHPLQGDEIFQSLTGESEKTFFKGSIIPV
RVERFWHNDIICTTNSEVECVVNAQRHAGAQLRRPANEIYEIGKTYPAKVIYIDYANITA
EVSLLDHDVKQQYVPISYSKDPSIWDLKQELEDAEEERKLMMAEARAKRTHRVINHPYYF
PFNGRQAEDYLRSKERGEFVIRQSSRGDDHLVITWKLDKDLFQHIDIQELEKENPLALGK
VLIVDNQKYNDLDQIIVEYLQNKVRLLNEMTSSEKFKSGTKKDVVKFIEDYSRVNPNKSV
YYFSLNHDNPGWFYLMFKINANSKLYTWNVKLTNTGYFLVNYNYPSVIQLCNGFKTLLKS
NSSKNRMNNYR
NT seq 4356 nt   +upstreamnt  +downstreamnt
atggaagagacgggagattcgaagctggtccctagggacgaggaagaaatagtaaatgac
aacgatgaaactaaagcgcctagtgaggaagaagaaggagaagatgtctttgactcctct
gaggaagacgaagatattgatgaagacgaagatgaggcaagaaaagtgcaagaaggcttc
attgtcaacgatgatgatgaaaatgaagacccaggaacaagtatttccaaaaaaagaaga
aaacataaaagaagagaaagagaagaagatgatcgactatccgaagatgatttggatttg
ttaatggagaatgctggtgttgaacgtaccaaagcgagctcctcttcaggaaaatttaaa
agattaaagagagtaggagatgaaggaaacgctgcagaatcagaaagtgacaacgtcgct
gcatcaaggcaagattctacgtctaaattggaagatttcttttctgaagatgaagaagaa
gaagaatctggtttacgcaacggtaggaacaatgaatatgggcgtgatgaagaagaccat
gaaaataggaacagaacagctgacaaaggtggaatcttggacgaattggatgatttcatt
gaagatgatgaattttctgatgaggacgacgaaaccagacaaaggaggatccaagaaaag
aagcttttaagagaacaatccatcaaacaacctacacagattactggtctatcgtcggat
aagattgacgagatgtatgacatttttggtgatggtcatgactacgattgggctttagaa
attgaaaatgaagaactagaaaatggtaacgacaacaatgaagctgaagaagaagagatc
gatgaagaaactggtgctataaaaagcaccaagaaaaagatatctctacaagacatttat
gatttagaggatttgaaaaaaaacttgatgactgaaggagacatgaaaattagaaagaca
gatattccagaaagatatcaagaattaagagcaggtattactgactacggaaatatgtca
tcggaggatcaagaattagaaagaaactggatagcagaaaaaatttctgtggataagaac
ttcgatgccaattatgatctcactgaatttaaagaagcaattgggaacgcaatcaaattt
atcaccaaagaaaacttggaagtcccttttatatatgcttaccgtcgtaactatatttcc
tcaagagaaaaagatgggtttcttttgactgaagatgacctttgggatatagttagcctt
gacatcgaatttcacagtcttgtgaacaaaaaggattatgtccagagattttatgcagaa
ttacatatcgatgatcctattgtcactgaatacttcaaaaatcagaatactgcatctatt
gcggaactgaattctctacaggatatttatgactacctagaattcaaatatgccaacgaa
atcaatgaaatgtttataaaccacactggaaagactggtaagaaacatttgaaaaattcc
agttatgaaaaatttaaagctagtcctctttatcaagcggttagtgatattggtatatca
gctgaggatgttggtgaaaatatcagttcccagcatcaaatccaccctcccgtagatcat
ccaagttccaaaccagtagaagtgatagaatctatattgaatgcaaacagcggtgatttg
caagtctttacgtccaatactaagctggcaattgatacggtccaaaaatactactctttg
gaattgtctaaaaatacaaaaataagggaaaaagttagatccgatttttccaaatattat
ctggctgacgttgtgttaactgctaaaggtaaaaaagaaattcaaaagggatctctgtat
gaggacataaaatatgccatcaatagaactccaatgcacttccgtagggatccagacgtt
tttttgaaaatggtcgaggctgagtctttgaacctgctcagtgttaagttacacatgtcg
tcacaagcccaatatatagagcatttattccaaattgcacttgaaactaccaatacctcg
gacatcgcaatagaatggaataacttccgtaaactggcattcaaccaagcgatggacaag
attttccaggatatatctcaagaagtcaaagacaatttaacaaaaaattgtcaaaaattg
gtagccaagactgttcgccataagtttatgacaaaattagaccaggctccattcattcct
aatgtcagggatccaaaaattccaaaaatcttatctttaacctgtggacagggtagattc
ggagccgacgctataattgctgtctacgtcaacagaaagggtgattttataagagattac
aagattgtcgacaatccatttgataagacgaatcctgaaaaatttgaagacaccttggat
aatatcattcaaagctgtcaaccgaatgccatcggaatcaatggccctaacccaaagact
caaaaattttacaaaagattacaagaagttctacataagaagcaaatcgtcgacagtaga
ggacatactattccaatcatttacgttgaggacgaagtcgctatccgttatcagaattcc
gaaagagctgctcaagaattccctaataaacctcctctagttaaatactgtatcgccttg
gcgcgctatatgcattccccattgttggaatatgctaatttaacaagtgaagaagtgaga
tcattgtcaattcatccacaccaaaatctgttatcctcagaacaattgagttgggctctt
gaaaccgctttcgttgatattgtcaacctggtaagtgttgaagttaacaaagccacagat
aataattactacgctagtgcgctgaaatacatctctggctttggaaaacgtaaagctatt
gatttcttacagtcccttcaaaggctaaatgaaccattactggctcgtcaacaattaatt
actcataacattcttcacaagactatttttatgaattccgcgggattcctctatatctca
tggaatgaaaaaagacaaaaatacgaagatttggaacatgatcaactagatagcactaga
attcatccagaagactaccatttggccaccaaggttgccgctgatgctttagaatacgat
cctgatactattgccgaaaaagaagaacaggggactatgagtgaattcattgaactgttg
agagaagatcctgaccgtagagctaaactagaatcactaaatctagaatcatacgcagaa
gaacttgagaagaataccggattaagaaaacttaataatctaaatacaattgtccttgaa
ttgttggatggatttgaagaattgagaaatgactttcatcctttgcaaggtgatgaaatt
ttccaaagtttgactggtgagtctgaaaagacgtttttcaagggtagtattattccagtc
agagtagaaagattctggcacaacgatataatttgcactacaaactctgaagttgaatgt
gtagtaaatgctcaacgtcacgcaggtgcacaattaagaagacctgcaaatgaaatatac
gaaattggtaaaacatatccagcaaaggtgatatatattgactatgctaatattactgca
gaagtttccttattagatcatgatgtcaaacagcaatatgttccaataagctacagtaaa
gatccttccatttgggacttgaaacaagaactggaagatgccgaagaggagaggaaattg
atgatggcagaagcccgtgcaaagagaacacatcgtgttatcaatcatccttactatttc
cctttcaacggcagacaggctgaggattacttaaggagtaaagaacgtggtgaattcgtg
atcagacagtctagccgaggtgatgaccacttggttatcacctggaaattggataaggat
ttgtttcaacatattgatatccaagaattagaaaaagaaaatcctttggctttaggtaaa
gtcttgattgtcgacaatcagaaatacaatgatttagaccagatcattgtagaatatctt
caaaacaaggtaaggctcttgaatgaaatgacatctagtgaaaaattcaaaagcggtact
aagaaagatgtggtcaagtttattgaagactactctagagtgaatccaaataagtctgtg
tactatttcagtttgaaccacgataaccctggttggttttacttgatgttcaagattaac
gcaaatagcaaattatacacatggaatgtgaaattaacgaacactggttatttcctggta
aactacaattatccaagtgttatccagctttgtaatggttttaagacgcttctaaaatct
aacagtagtaagaatagaatgaacaactaccgttag

DBGET integrated database retrieval system