KEGG   Saccharomyces cerevisiae (budding yeast): YGR136WHelp
Entry
YGR136W           CDS       T00005                                 

Gene name
LSB1
Definition
(RefSeq) Lsb1p
  KO
K20522  LAS seventeen-binding protein 1/2
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sce04131]
    YGR136W (LSB1)
Membrane trafficking [BR:sce04131]
 Others
  Actin-binding proteins
   Nucleation-promoting factors (NPFs)
    YGR136W (LSB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SH3_1 SH3_9 SH3_2
Motif
Other DBs
NCBI-GeneID: 853037
NCBI-ProteinID: NP_011652
SGD: S000003368
UniProt: P53281
Position
VII:762428..763153
Genome map
AA seq 241 aa AA seqDB search
MSASLVNRSLKNIRNELEFLKESNVISGDIFELINSKLPEKWDGNQRSPQNADTEEYVEA
LYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRGKSNNKIGIFPANYVKPAFTRSASPKSA
EAASSSTVSRPSVPPPSYEPAASQYPSQQVSAPYAPPAGYMQAPPPQQQQAPLPYPPPFT
NYYQQPQQQYAPPSQQAPVEAQPQQSSGASSAFKSFGSKLGNAAIFGAGSAIGSDIVNSI
F
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcgtcactagtgaatcgatcattgaaaaatataaggaatgaattagaatttttg
aaggaatcaaacgtcatatcaggcgacattttcgaattaatcaatagcaagttacctgag
aaatgggatggaaaccaaagatcgccccaaaatgcagatacagaagagtacgttgaagct
ttatatgattttgaagctcaacaagatggagatttgtcattgaaaacaggtgataaaata
caagttttagagaagatttctccagattggtatagaggcaagtcaaataataagatcgga
atattccctgcaaattatgtgaaacctgctttcacgagatcagcctcacctaaatctgcg
gaagctgcttcaagctcgactgtttctcgtcccagtgttccacctccatcatacgaacca
gccgcatcacagtatccttcacagcaggtttcagcaccttatgcacctccagccggttat
atgcaagctccgcctccacagcaacagcaggcgcctttaccatatcctccacctttcact
aattactatcaacagcctcagcaacagtacgcaccaccttcacagcaagcaccggtggaa
gcacaaccgcaacagagcagtggggctagtagtgccttcaagagttttggtagcaaattg
ggaaatgctgctatatttggcgctggttctgctattggtagtgatattgtcaacagcatt
ttttag

DBGET integrated database retrieval system