KEGG   Saccharomyces cerevisiae (budding yeast): YGR140WHelp
Entry
YGR140W           CDS       T00005                                 

Gene name
CBF2, CEP2, CSL5, CTF14, NDC10
Definition
(RefSeq) Cbf2p
  KO
K11574  centromere DNA-binding protein complex CBF3 subunit A
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sce03036]
    YGR140W (CBF2)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CBF3 complex
     YGR140W (CBF2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDC10_II GCR1_C
Motif
Other DBs
NCBI-GeneID: 853041
NCBI-ProteinID: NP_011656
SGD: S000003372
UniProt: P32504
Structure
PDB: 

Position
VII:767429..770299
Genome map
AA seq 956 aa AA seqDB search
MRSSILFLLKLMKIMDVQQQQEAMSSEDRFQELVDSLKPRTAHQYKTYYTKYIQWCQLNQ
IIPTPEDNSVNSVPYKDLPISAELIHWFLLDTLITDDKPGEKREETEDLDEEEENSFKIA
TLKKIIGSLNFLSKLCKVHENPNANIDTKYLESVTKLHTHWIDSQKAITTNETNNTNTQV
LCPPLLKVSLNLWNPETNHLSEKFFKTCSEKLRFLVDFQLRSYLNLSFEERSKIRFGSLK
LGKRDRDAIIYHKVTHSAEKKDTPGHHQLLALLPQDCPFICPQTTLAAYLYLRFYGIPSV
SKGDGFPNLNADENGSLLQDIPILRGKSLTTYPREETFSNYYTTVFRYCHLPYKRREYFN
KCNLVYPTWDEDTFRTFFNEENHGNWLEQPEAFAFPDKIPFDFKKIMNFKSPYTSYSTNA
KKDPFPPPKDLLVQIFPEIDEYKRHDYEGLSQNSRDFLDLMEVLRERFLSNLPWIYKFFP
NHDIFQDPIFGNSDFQSYFNDKTIHSKGSPILSFDILPGFNKIYKNKTNFYSLLIERPSQ
LTFASSHNPDTHPTQKQESEGPLQMSQLDTTQLNELLKQQSFEYVQFQTLSNFQILLSVF
NKIFEKLEMKKSSRGYILHQLNLFKITLDERIKKSKIDDADKFIRDNQPIKKEENIVNED
GPNTSRRTKRPKQIRLLSIADSSDESSTEDSNVFKKDGESIEDGAYGENEDENDSEMQEQ
LKSMINELINSKISTFLRDQMDQFELKINALLDKILEEKVTRIIEQKLGSHTGKFSTLKR
PQLYMTEEHNVGFDMEVPKKLRTSGKYAETVKDNDDHQAMSTTASPSPEQDQEAKSYTDE
QEFMLDKSIDSIEGIILEWFTPNAKYANQCVHSMNKSGNKSWRANCEALYKERKSIVEFY
IYLVNHESLDRYKAVDICEKLRDQNEGSFSRLAKFLRKWRHDHQNSFDGLLVYLSN
NT seq 2871 nt NT seq  +upstreamnt  +downstreamnt
atgagatcatcgattttgtttctactaaaattgatgaaaattatggatgttcagcaacag
caagaagctatgtcatcagaagataggtttcaggaactggtggactccctaaagccaaga
actgcgcatcagtacaagacctactatactaagtacatacaatggtgtcagctcaatcaa
attataccgacaccggaggacaattctgtaaatagcgtcccctataaagacctgccaata
tctgctgaactgatacattggtttttgttagatacattaataaccgatgataagcctgga
gagaaaagagaagagactgaagatcttgatgaggaggaggagaattcattcaagatcgct
acgttgaagaaaattataggcagtctcaattttttgtcaaaattgtgcaaagttcatgaa
aatccaaatgctaatatagacacaaaatacctggagtcagtcaccaagcttcatacccat
tggatagattcacaaaaggcaatcaccactaatgaaacaaataacacaaatactcaagtg
ctgtgtccaccattattgaaagtgtctttgaatttatggaacccagaaactaaccatctc
tctgagaaattttttaaaacctgttctgaaaaattaagattcctggtggattttcaatta
agaagttatttgaacctttcatttgaagaaagatcaaagatacgatttggttccctcaag
ctcggtaaaagggacagagacgctataatttatcataaagtaactcattcggcggaaaaa
aaagatacgccgggccaccatcaactccttgcattattaccccaagattgtccatttatc
tgccctcaaactacattagctgcatatttgtatttaaggttctatggtataccatctgtt
tcgaaaggggatggctttcccaatttgaacgctgatgaaaatggctcacttttacaagat
attcccatactaagaggcaaatcactgacaacttatcccagagaggaaacatttagtaat
tattatacaaccgtgtttaggtattgccacttaccttataaaagaagagaatatttcaac
aaatgtaaccttgtttacccaacttgggatgaagacacttttagaacatttttcaatgaa
gaaaaccatggaaattggttagaacaacctgaggcctttgcgttccctgacaaaataccg
ttcgacttcaagaaaatcatgaacttcaaatcgccctacacttcgtattctacaaacgct
aaaaaggacccttttccgcctccaaaggatttattagttcaaatatttccggagattgat
gaatataaaagacatgattatgaaggtttgtctcagaattcaagggattttctagattta
atggaagttttacgagaaagatttttgagcaatctaccatggatttacaaattctttcct
aatcatgatatattccaggaccccatttttggaaattccgattttcaatcatacttcaat
gacaaaactatacattcaaagggttcacccattttatcattcgatatactaccaggcttt
aataaaatctataagaataagacaaatttttactcactcttaatagaaaggccttcgcag
ttgacatttgcttcgagtcataatccagatacacaccccactcaaaaacaagaatctgag
gggccattacaaatgagtcaacttgatactacacaattaaatgaattattgaagcaacag
agtttcgaatatgtgcagttccaaacactttctaatttccaaattttattatcggtattc
aataaaatttttgagaaattggagatgaaaaaatcttcaagaggctatattttacatcag
cttaatttattcaaaattaccttggatgaaagaattaagaaatctaagattgacgatgcc
gataaatttatacgtgataatcagcccattaaaaaagaagaaaacattgtgaatgaagat
gggcctaacacatcaaggcggacaaagaggccgaagcaaattagattactctcaattgcg
gattcctccgacgaatcctccacggaggattcaaatgtattcaaaaaggacggtgaatcc
atcgaagatggcgcatatggagaaaatgaagatgagaatgactctgagatgcaagagcag
ttaaaatctatgataaacgaacttataaactccaaaataagcacttttttacgggaccaa
atggatcaatttgaattgaaaataaacgctttattagataaaattcttgaagaaaaagtc
actcgtattatcgagcaaaaacttggttcacacacggggaagttttcaacgttgaagagg
ccacaactatacatgacggaagaacacaatgttggatttgatatggaagttcctaaaaaa
cttaggaccagtggtaagtacgcagagactgtgaaagataatgatgatcatcaagccatg
tcaactactgcatcgccgtctcctgagcaagatcaagaagcaaagagctatactgacgaa
caagaatttatgctggacaaatccatagacagcatagagggaatcattcttgaatggttc
accccaaacgctaagtacgccaaccaatgcgtgcattcaatgaacaaatcaggtaacaag
tcgtggagagctaattgtgaagctttatacaaggaaagaaaatcaattgttgaattctat
atttatttggtaaatcatgagagtctcgacagatacaaagcagttgatatttgcgaaaaa
ttacgagatcagaacgaaggttcattttcgcgcttggcaaagttcctaaggaagtggagg
catgaccatcaaaattcatttgatggtctgttagtatatctatctaactga

DBGET integrated database retrieval system