KEGG   Saccharomyces cerevisiae (budding yeast): YGR145WHelp
Entry
YGR145W           CDS       T00005                                 

Gene name
ENP2
Definition
(RefSeq) ribosome biosynthesis protein ENP2
  KO
K14788  ribosome biogenesis protein ENP2
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:sce03009]
    YGR145W (ENP2)
Ribosome biogenesis [BR:sce03009]
 Eukaryotic Type
  90S particles
   Other 90S particles
    YGR145W (ENP2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUC153
Motif
Other DBs
NCBI-GeneID: 853048
NCBI-ProteinID: NP_011661
SGD: S000003377
UniProt: P48234
Position
VII:781767..783890
Genome map
AA seq 707 aa AA seqDB search
MVLKSTSANDVSVYQVSGTNVSRSLPDWIAKKRKRQLKNDLEYQNRVELIQDFEFSEASN
KIKVSRDGQYCMATGTYKPQIHVYDFANLSLKFDRHTDAENVDFTILSDDWTKSVHLQND
RSIQFQNKGGLHYTTRIPKFGRSLVYNKVNCDLYVGASGNELYRLNLEKGRFLNPFKLDT
EGVNHVSINEVNGLLAAGTETNVVEFWDPRSRSRVSKLYLENNIDNRPFQVTTTSFRNDG
LTFACGTSNGYSYIYDLRTSEPSIIKDQGYGFDIKKIIWLDNVGTENKIVTCDKRIAKIW
DRLDGKAYASMEPSVDINDIEHVPGTGMFFTANESIPMHTYYIPSLGPSPRWCSFLDSIT
EELEEKPSDTVYSNYRFITRDDVKKLNLTHLVGSRVLRAYMHGFFINTELYDKVSLIANP
DAYKDEREREIRRRIEKERESRIRSSGAVQKPKIKVNKTLVDKLSQKRGDKVAGKVLTDD
RFKEMFEDEEFQVDEDDYDFKQLNPVKSIKETEEGAAKRIRALTAAEESDEERIAMKDGR
GHYDYEDEESDEEESDDETNQKSNKEELSEKDLRKMEKQKALIERRKKEKEQSERFMNEM
KAGTSTSTQRDESAHVTFGEQVGELLEVENGKKSNESILRRNQRGEAELTFIPQRKSKKD
GNYKSRRHDNSSDEEGIDENGNKKDNGRSKPRFENRRRASKNAFRGM
NT seq 2124 nt NT seq  +upstreamnt  +downstreamnt
atggttttgaaatctacttccgcaaatgatgtttcagtatatcaggtttctggtacaaac
gtttcaagatcacttccagactggattgcgaaaaagcgcaaaaggcaattaaagaatgat
ttagaatatcaaaatagagtagaactgattcaagattttgaatttagcgaagcctccaat
aagattaaagtgagtagagatgggcaatattgcatggctaccggtacatacaaacctcag
atccatgtctacgattttgctaatttgtcactgaagttcgatagacacacagatgctgaa
aacgtggatttcactattctctctgacgattggactaaaagtgtacatttacaaaatgat
agaagtattcaattccaaaacaaaggtggtctacattacaccacaagaattcctaaattt
gggagaagtttagtttacaataaggtaaactgtgatttatatgttggtgcgagcggtaat
gagttatacaggttgaacttggaaaaggggagatttttaaacccattcaagttggatact
gaaggcgtgaaccatgtttctatcaatgaagtaaatgggttgttagcggcaggcacggaa
acaaatgtagtggaattctgggatccaaggtcgcgttcccgtgtttcaaagctatattta
gagaacaatattgacaacagaccattccaagtcaccacaaccagtttccgtaatgacggg
ttaacttttgcatgtggtacgtcgaacggttattcatacatttatgacttgcgtacttct
gaaccttccattattaaagaccaaggttatgggtttgacattaagaaaattatttggttg
gataacgtcggcacggaaaataaaattgttacatgtgacaagagaattgcaaaaatatgg
gatagactagatggtaaggcatacgcttctatggagcctagtgttgatattaacgacatt
gagcatgtaccaggtacaggtatgtttttcaccgctaacgaaagtattcccatgcataca
tattatattccaagtttaggaccatctccacgctggtgctcattcttggattctatcaca
gaagaattagaagaaaaaccaagtgacactgtttactctaactacaggttcattactaga
gacgacgttaaaaaattgaatttaacgcacttggtgggatccagagtattaagagcatac
atgcatggtttctttattaacactgaactttacgataaggtttcattaattgctaatcca
gatgcctacaaagatgaaagagaaagagaaattagacgtagaattgagaaagaaagagaa
tccagaatcagaagttcaggggctgttcaaaaacctaaaattaaagtcaataaaacattg
gttgataaactatctcaaaaacgtggtgataaagttgcaggaaaggttcttacggatgac
cgtttcaaagaaatgtttgaggatgaagaatttcaagtcgatgaagatgactatgatttc
aaacaattgaatccagtaaaatccatcaaagaaaccgaagaaggtgctgctaaacgtatt
agggcgctaactgctgccgaagagtccgacgaagaaagaattgcaatgaaggatggcaga
ggtcactatgactacgaggatgaagagtctgatgaagaagaatctgatgatgaaacgaac
caaaagtcaaataaggaagaattaagtgaaaaagatttgagaaagatggaaaagcaaaag
gcactaattgaacgcagaaagaaggaaaaggagcaaagcgaacgttttatgaacgaaatg
aaagccggcacttccacgagtacgcaaagagacgaaagtgctcacgttacatttggcgaa
caagtaggcgaattgcttgaggtggaaaatggaaagaaatcaaatgaatccattttacgt
cgtaaccaacgcggtgaagcagaacttacttttattcctcaaagaaaaagcaaaaaagac
ggaaattataaatccaggcgtcatgataattcatcggatgaagaaggtattgacgaaaat
ggtaataagaaggacaatggtaggtcgaagcccagattcgaaaatagaagaagagctagc
aaaaatgcgttccgtggtatgtag

DBGET integrated database retrieval system