KEGG   Saccharomyces cerevisiae (budding yeast): YGR147CHelp
Entry
YGR147C           CDS       T00005                                 

Gene name
NAT2
Definition
(RefSeq) Nat2p
  KO
K20815  N-terminal acetyltransferase 2
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99974 Translation
    YGR147C (NAT2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1279
Motif
Other DBs
NCBI-GeneID: 853050
NCBI-ProteinID: NP_011663
SGD: S000003379
UniProt: P37293
Position
VII:complement(786054..786920)
Genome map
AA seq 288 aa AA seqDB search
MMVPRISASPVFKRIFLRWGFVTLPIQKTVSHTLRRDFSAPCRSMVKCLLLRPGISVHSA
QDRKFYSTEEKSSQFDENKSKSNNGKKNEPHGIKGLMAKYGYSALIVYILLTCVDLPLCF
LGVHSLGEEKIKIYLNRGKQLIGMGEPDESKVIQDVRRKQAHREAVQAENADKVEDASRK
TFNERWQEMKDSTLLAELLIAYGIHKSLIIVRVPLTAVLTPSFVKLLQRFGIDLMKKQKK
VFQTMASGAKIRYKGNNPSDFIKNEGTALDITKRKPRTKGQKWFDGLM
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgatggtacccaggattagtgcttcaccagttttcaagaggatatttcttcgatgggga
tttgtaactttacccatacagaaaaccgtatcccatacactgcgcagggactttagtgcc
ccttgtaggagtatggtaaaatgccttctcctacgacctgggataagtgtgcactcagca
caagacagaaaattttacagtacagaggaaaaaagtagtcagtttgatgaaaataaaagc
aaaagtaacaatgggaagaaaaatgagccacacggtattaaaggattaatggctaagtat
ggttattctgcactgatcgtatatatcctcttaacttgtgttgatttgccattatgtttt
ctgggagtccactcactaggtgaagagaagattaagatctatctgaacagaggtaagcaa
ttgattgggatgggtgagcctgacgaaagcaaagtcattcaagatgttagaaggaaacag
gctcatcgcgaagcagtgcaagcagagaatgctgacaaggtggaggacgcatcgaggaaa
actttcaatgagagatggcaagagatgaaggacagcacgttgttggccgaattgctaatt
gcgtatggcatacacaagagtttgatcatcgttagagtacccctgacggcagtgctaacg
ccatccttcgtcaagcttctgcagaggtttggcatcgacttgatgaagaagcagaaaaag
gtattccaaacgatggcctctggtgccaaaataagatacaaagggaacaaccctagcgat
ttcatcaagaatgagggcacagcgctcgacattacaaagcgcaaaccaagaaccaaaggc
cagaaatggtttgatggcctaatgtga

DBGET integrated database retrieval system