KEGG   Saccharomyces cerevisiae (budding yeast): YGR148CHelp
Entry
YGR148C           CDS       T00005                                 

Gene name
RPL24B, RPL30B
Definition
(RefSeq) ribosomal 60S subunit protein L24B
  KO
K02896  large subunit ribosomal protein L24e
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03010  Ribosome
Module
sce_M00177  Ribosome, eukaryotes
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    YGR148C (RPL24B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:sce03011]
    YGR148C (RPL24B)
Ribosome [BR:sce03011]
 Ribosomal Proteins
  Eukaryotes
   Large subunit
    YGR148C (RPL24B)
  Archaea
    YGR148C (RPL24B)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L24e
Motif
Other DBs
NCBI-GeneID: 853051
NCBI-ProteinID: NP_011664
SGD: S000003380
UniProt: P24000
Position
VII:complement(787312..787779)
Genome map
AA seq 155 aa AA seqDB search
MKVEVDSFSGAKIYPGRGTLFVRGDSKIFRFQNSKSASLFKQRKNPRRIAWTVLFRKHHK
KGITEEVAKKRSRKTVKAQRPITGASLDLIKERRSLKPEVRKANREEKLKANKEKKRAEK
AARKAEKAKSAGVQGSKVSKQQAKGAFQKVAATSR
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atgaaggttgaagttgattccttttccggcgctaagatctacccaggtagaggtacttta
tttgtccgtggtgactccaaaattttcagattccaaaactccaaatctgcttctttgttc
aaacaaagaaagaacccaagaagaatcgcttggaccgtcttgttcagaaagcatcacaag
aagggtatcaccgaagaagttgctaagaagagatctagaaagaccgttaaggcgcaaaga
ccaatcactggtgcttctttggacttgatcaaggaaagaagatctttgaagccagaagtt
agaaaagctaacagagaagaaaaattgaaagccaacaaggaaaagaagagagctgaaaag
gctgctagaaaggctgaaaaggctaagtccgctggtgtccaaggttccaaggtttccaag
caacaagctaagggtgctttccaaaaggttgccgccacttcccgttaa

DBGET integrated database retrieval system