KEGG   Saccharomyces cerevisiae (budding yeast): YGR150CHelp
Entry
YGR150C           CDS       T00005                                 

Gene name
CCM1, DMR1, RRG2
Definition
(RefSeq) Ccm1p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PPR_2 PPR PPR_3 PPR_long PPR_1
Motif
Other DBs
NCBI-GeneID: 853053
NCBI-ProteinID: NP_011666
SGD: S000003382
UniProt: P48237
Position
VII:complement(790459..793053)
Genome map
AA seq 864 aa AA seqDB search
MYMARCGPKNNVLCFPFQLSFLFSKRLINKRFKYTLQTEDEKNMMGSLSKNKIITPEDVE
FKLAQLREFSNTLKERIHNTKSVNSDGHQSNSIAPISEDSRNVNVTKTSSVPNEEKSKNL
SDLIHSSFLEKMDHLVPKVIRERVADDDILAKNLFDRSHSNWAPVIDRLYVSEKRFMDID
SREFSVWLNGTVKYLPFHSILHLDEMLLEQINGDVVKFNTHMYECIFNNLGNLKPTNFNQ
DGTNDKVILKMKELLERYDKALKITEERINKKEGFPSKVPKMTQAILNNCLKYSTKCSSF
HDMDYFITKFRDDYGITPNKQNLTTVIQFYSRKEMTKQAWNTFDTMKFLSTKHFPDICTY
NTMLRICEKERNFPKALDLFQEIQDHNIKPTTNTYIMMARVLASSSSNAVVSEGKSDSLR
LLGWKYLHELEDKNLYRHKKDDLNLFLAMMALAAFDGDIELSRALYYLFIAKKYKTLCAN
WKGNILVDQDTIWKSTLMPEMLNYLMLAYARFDPRNLPVLSGYEKGIELRRKFLREFDSS
MRLDDTDKLVKFKLPFLPISDLNSEAQVLAESNAIWSFNMENGGTRNTLTSSNEAALEDI
KKYRQLLDSFAQEAEDFNEFKFKVMYEVTKMQRESINVNVFNKISLHTYLSIPINLKQQK
EFLRRLTFFTFQQHEFEAVIKRLYEGYRNIPSSHTRDQNSISTEAISVSKPETTEDLNLI
MHDIWYITCLRHKIMMDTTLYELVMKAAIEFQNEDLAKKVWNDRGKFRTTVPFLKMDQRI
RIAKDQKFAHLMVEFFTKQGKYSDAIAIILSSKNRFNWTYSMVRNLHKALEEIEDRNSVE
ILLDVVNKKSHAKALKWEEQELNM
NT seq 2595 nt NT seq  +upstreamnt  +downstreamnt
atgtacatggccagatgtggccccaagaataatgtgctgtgtttcccatttcaactttcc
tttctattttcaaaacgactaataaataagcgtttcaagtataccctacaaactgaagat
gaaaagaatatgatggggagtttaagtaaaaataaaataataacacctgaagacgttgag
ttcaaattagcacaattacgagaattttctaatactttaaaagaacgcattcacaacact
aaatcggtgaattcagatggccaccaaagcaatagtatcgcaccaatctcagaagactca
aggaatgttaatgtcaccaaaacatcatctgttcctaatgaagaaaaatccaaaaatcta
tcagatttgattcattcttcgtttttagaaaaaatggatcacctcgtaccaaaagttata
agagaaagagtagcagacgacgacatacttgcaaaaaacctttttgatagatcacacagt
aattgggcacctgtcatagataggctttatgtcagtgagaaacggttcatggatattgat
tccagagaattttctgtttggttaaatggtacagtcaaatatttgccatttcatagtata
ctacacttggatgaaatgctattagaacaaatcaatggagatgttgtaaaatttaatacc
cacatgtacgaatgtatctttaacaacttaggaaatttaaaaccaactaattttaatcag
gatggtactaacgataaagttatcctcaaaatgaaagagttgttagagaggtatgataag
gcattaaaaataactgaagaaagaattaacaaaaaagaaggattcccttccaaagtacca
aagatgacgcaagcaatacttaataattgtttaaaatactcgaccaagtgttcaagcttt
cacgacatggattattttattacaaaattcagagatgattatggcataactcctaataag
caaaacctaactactgtaatacaattctactctaggaaggaaatgactaagcaagcctgg
aatacttttgacaccatgaaatttttatctacaaagcatttccctgatatctgcacatat
aacacaatgctgcgaatatgcgagaaggaacggaattttcctaaggctttggatttattt
caagaaattcaagaccacaatataaagcctacaacaaacacttacataatgatggcaaga
gtgttggcttcttcgagcagtaatgccgttgtcagtgagggtaaatcagactctctaaga
ttactgggatggaaataccttcatgagttggaggacaagaatctttacagacataaaaaa
gatgacttaaatttatttttggctatgatggcattagccgcgtttgatggtgatattgaa
ttaagtagagctctatattacttgttcatcgcgaaaaagtacaaaactttgtgcgcaaat
tggaaaggaaacattctcgtagatcaagatacaatttggaagtcaactttaatgccagaa
atgctgaattatttgatgcttgcttatgcaagatttgatcccagaaatttgccagtctta
tccggttatgaaaaaggcattgaattgagaagaaaatttcttcgcgaatttgattcctcc
atgaggttagatgatacagacaaattggtcaaatttaaattaccatttcttccaattagt
gacctaaattcggaggcacaagtattggcggaatctaacgcaatctggagtttcaatatg
gaaaatggaggaacgcgcaatacattgacatcttcaaatgaagcggcgttggaggatatc
aaaaaatataggcaattacttgattcgtttgcgcaagaagcagaggatttcaacgagttt
aagtttaaagttatgtacgaagtgacgaaaatgcaaagagaaagtattaatgtgaacgtc
ttcaataaaatttcactacacacatatttgtcaattcccattaacttaaaacaacagaag
gaattcttgcgaaggttgacgttcttcactttccaacaacacgaatttgaagctgtcata
aagcgtttgtatgaaggataccgtaatattccttcgtcccatacgcgtgaccaaaattca
atatcaactgaagccatctcagtatccaaacctgagaccacggaagacctcaacttaata
atgcatgatatatggtatattacatgtttgaggcacaaaatcatgatggacaccacgtta
tatgagctggtgatgaaagccgctatagaatttcaaaatgaggacttagcaaagaaagta
tggaatgataggggtaaatttaggacgactgtaccgtttctgaaaatggaccaaagaata
agaatagcaaaggatcagaaatttgcccatctaatggttgaattcttcacaaagcaagga
aagtattcggacgcaatagctatcatattgtcttcaaaaaatcgcttcaattggacttat
tccatggttaggaatttgcataaagcattagaagaaatcgaggatagaaatagcgttgaa
atcttactggatgtagtaaacaaaaagtcacacgcaaaggccctgaagtgggaggaacaa
gaacttaacatgtag

DBGET integrated database retrieval system