KEGG   Saccharomyces cerevisiae (budding yeast): YGR152CHelp
Entry
YGR152C           CDS       T00005                                 

Gene name
RSR1, BUD1
Definition
(RefSeq) Ras family GTPase RSR1
  KO
K07836  Ras-related protein Rap-1B
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sce04147]
    YGR152C (RSR1)
   04031 GTP-binding proteins [BR:sce04031]
    YGR152C (RSR1)
Exosome [BR:sce04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   YGR152C (RSR1)
  Exosomal proteins of other body fluids (saliva and urine)
   YGR152C (RSR1)
  Exosomal proteins of colorectal cancer cells
   YGR152C (RSR1)
GTP-binding proteins [BR:sce04031]
 Small (Monomeric) G-proteins
  Ras Family
   Rap [OT]
    YGR152C (RSR1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 DUF4674
Motif
Other DBs
NCBI-GeneID: 853056
NCBI-ProteinID: NP_011668
SGD: S000003384
UniProt: P13856
Position
VII:complement(794674..795492)
Genome map
AA seq 272 aa AA seqDB search
MRDYKLVVLGAGGVGKSCLTVQFVQGVYLDTYDPTIEDSYRKTIEIDNKVFDLEILDTAG
IAQFTAMRELYIKSGMGFLLVYSVTDRQSLEELMELREQVLRIKDSDRVPMVLIGNKADL
INERVISVEEGIEVSSKWGRVPFYETSALLRSNVDEVFVDLVRQIIRNEMESVAVKDARN
QSQQFSKIESPSTRLPSSAKQDTKQSNNKQSSKGLYNKSSQGQAKVKQSTPVNEKHKPSH
AVPKSGSSNRTGISATSQQKKKKKNASTCTIL
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgagagactataaattagtagtattgggtgctggtggtgtcggtaaatcctgcttaacc
gtgcagtttgtacagggagtttatttggatacgtatgatccaacgatcgaagattcttac
aggaaaaccatcgagatcgataacaaggtattcgacctggaaattttagatacagcgggt
atagcacaatttactgcaatgagagaattatacataaagtcaggaatggggttcctgttg
gtatattcagtaacagatcggcaatctttggaagaattaatggagctaagagaacaggtc
cttaggatcaaagattccgatcgcgttccaatggttctaataggtaacaaggctgatcta
atcaatgaaagggtaataagtgtggaagaaggtatagaggtaagcagtaaatggggtaga
gttcccttttatgaaacaagcgctttgttgaggagcaatgtggatgaagtgttcgttgat
ttagttaggcaaatcattcggaatgaaatggaaagtgttgcagttaaagacgcaagaaat
caaagtcaacaatttagcaaaatcgagtctccatcaaccaggctccctagttctgcgaaa
caggatacgaaacaatcaaacaataagcaatcatcaaaaggtttatataacaaatcttca
caaggacaagctaaagttaaacaatctactccggttaatgaaaagcacaaaccgtcacat
gccgttccgaaatctggttctagcaacaggacaggaattagcgctacttcacaacaaaag
aaaaagaagaaaaacgcttccacttgcactattctatag

DBGET integrated database retrieval system