KEGG   Saccharomyces cerevisiae (budding yeast): YGR155WHelp
Entry
YGR155W           CDS       T00005                                 

Gene name
CYS4, NHS5, STR4, VMA41
Definition
(RefSeq) cystathionine beta-synthase CYS4
  KO
K01697  cystathionine beta-synthase [EC:4.2.1.22]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00260  Glycine, serine and threonine metabolism
sce00270  Cysteine and methionine metabolism
sce01100  Metabolic pathways
sce01130  Biosynthesis of antibiotics
sce01230  Biosynthesis of amino acids
Module
sce_M00338  Cysteine biosynthesis, homocysteine + serine => cysteine
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    YGR155W (CYS4)
   00270 Cysteine and methionine metabolism
    YGR155W (CYS4)
Enzymes [BR:sce01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.22  cystathionine beta-synthase
     YGR155W (CYS4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP CBS
Motif
Other DBs
NCBI-GeneID: 853059
NCBI-ProteinID: NP_011671
SGD: S000003387
UniProt: P32582
Structure
PDB: 

Position
VII:798543..800066
Genome map
AA seq 507 aa AA seqDB search
MTKSEQQADSRHNVIDLVGNTPLIALKKLPKALGIKPQIYAKLELYNPGGSIKDRIAKSM
VEEAEASGRIHPSRSTLIEPTSGNTGIGLALIGAIKGYRTIITLPEKMSNEKVSVLKALG
AEIIRTPTAAAWDSPESHIGVAKKLEKEIPGAVILDQYNNMMNPEAHYFGTGREIQRQLE
DLNLFDNLRAVVAGAGTGGTISGISKYLKEQNDKIQIVGADPFGSILAQPENLNKTDITD
YKVEGIGYDFVPQVLDRKLIDVWYKTDDKPSFKYARQLISNEGVLVGGSSGSAFTAVVKY
CEDHPELTEDDVIVAIFPDSIRSYLTKFVDDEWLKKNNLWDDDVLARFDSSKLEASTTKY
ADVFGNATVKDLHLKPVVSVKETAKVTDVIKILKDNGFDQLPVLTEDGKLSGLVTLSELL
RKLSINNSNNDNTIKGKYLDFKKLNNFNDVSSYNENKSGKKKFIKFDENSKLSDLNRFFE
KNSSAVITDGLKPIHIVTKMDLLSYLA
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgactaaatctgagcagcaagccgattcaagacataacgttatcgacttagttggtaac
accccattgatcgcactgaaaaaattgcctaaggctttgggtatcaaaccacaaatttat
gctaagctggaactatacaatccaggtggttccatcaaagacagaattgccaagtctatg
gtggaagaagctgaagcttccggtagaattcatccttccagatctactctgatcgaacct
acttctggtaacaccggtatcggtctagctttaatcggcgccatcaaaggttacagaact
atcatcaccttgccggaaaaaatgtctaacgagaaagtttctgtcctaaaggctctgggt
gctgaaatcatcagaactccaactgctgctgcctgggattctccagaatcacatattggt
gttgctaagaagttggaaaaagagattcctggtgctgttatacttgaccaatataacaat
atgatgaacccagaagctcattactttggtactggtcgcgaaatccaaagacagctagaa
gacttgaatttatttgataatctacgcgctgttgttgctggtgctggtactggtgggact
attagcggtatttccaagtacttgaaagaacagaatgataagatccaaatcgttggtgct
gacccattcggttcaattttagcccaacctgaaaacttgaataagactgatatcactgac
tacaaagttgagggtattggttatgattttgttcctcaggttttggacagaaaattaatt
gatgtttggtataagacagacgacaagccttctttcaaatacgccagacaattgatttct
aacgaaggtgtcttggtgggtggttcttccggttctgccttcactgcggttgtgaaatac
tgtgaagaccaccctgaactgactgaagatgatgtcattgttgccatattcccagattcc
atcaggtcgtacctaaccaaattcgtcgatgacgaatggttgaaaaagaacaatttgtgg
gatgatgacgtgttggcccgttttgactcttcaaagctggaggcttcgacgacaaaatac
gctgatgtgtttggtaacgctactgtaaaggatcttcacttgaaaccggttgtttccgtt
aaggaaaccgctaaggtcactgatgttatcaagatattaaaagacaatggctttgaccaa
ttgcctgtgttgactgaagacggcaagttgtctggtttagttactctctctgagcttcta
agaaaactatcaatcaataattcaaacaacgacaacactataaagggtaaatacttggac
ttcaagaaattaaacaatttcaatgatgtttcctcttacaacgaaaataaatccggtaag
aagaagtttattaaattcgatgaaaactcaaagctatctgacttgaatcgtttctttgaa
aaaaactcatctgccgttatcactgatggcttgaaaccaatccatatcgttactaagatg
gatttactgagctacttagcataa

DBGET integrated database retrieval system