KEGG   Saccharomyces cerevisiae (budding yeast): YGR156WHelp
Entry
YGR156W           CDS       T00005                                 

Gene name
PTI1
Definition
(RefSeq) cleavage polyadenylation factor subunit PTI1
  KO
K14407  cleavage stimulation factor subunit 2
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    YGR156W (PTI1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sce03019]
    YGR156W (PTI1)
Messenger RNA biogenesis [BR:sce03019]
 Eukaryotic Type
  mRNA processing factors
   3' end processing
    Cleavage stimulation factor (CSTF) complex
     YGR156W (PTI1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CSTF2_hinge CSTF_C RRM_1 MarR
Motif
Other DBs
NCBI-GeneID: 853060
NCBI-ProteinID: NP_011672
SGD: S000003388
UniProt: P39927
Position
VII:800546..801823
Genome map
AA seq 425 aa AA seqDB search
MTDPRRRTGRHFLTPENLSSTLQITNLPPEWNQDIITSVVAGSGPVIDIKAKNDPRTGKL
TGVLFDYLTSKDCKRAWEILNRIENFPVKIEQIIPPNYKDHLRETANKNSQKQVLQLNRD
SYPFEAGLELPFEMVTEVPIPRRPPPPQAANNTNSVSNNTNIQFPDILSKASKHLPSFQD
GSIIAPDKISQNLSKIPPLQLIEIISNLKILSNQENIQKSQLESFLDTNSDITISVTQAL
LEMGFIDYSVVTKVLKSQVGEAPSLLSSNNTSNSNTPVSVIRNNTPLHVPSNEVSNNPNN
MPLNVAMPMPMSTPPFIPLPLQQQPFGFAPPGPFMPPAQGPSMGQPVLANQLGQVQQQNI
SSTEGPSNANKANDSGTINMAKLQLLPENQQDMIKQVLTLTPAQIQSLPSDQQLMVENFR
KEYII
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgacagatcccagaagaagaacaggccgtcatttcttgacaccggagaatttatcctct
acattacaaatcacaaacttacctccagaatggaaccaagatataattacttcggtcgtg
gccggttctggtccagttatagatataaaagctaagaatgacccgagaactggtaaacta
accggtgtactgttcgattatttgactagtaaagattgtaaacgcgcttgggaaatttta
aatagaattgaaaactttcccgtaaagatagagcaaataatcccaccaaattataaggac
catcttagagaaacagcaaataaaaattctcaaaagcaggtattacaacttaatagagat
tcgtaccccttcgaggcgggtttggagctacctttcgaaatggtgacagaagtccccatt
cctaggcgaccaccgccaccacaggctgcaaataacacaaactctgtatcaaataacaca
aacattcaattccccgacatactaagtaaagcatctaaacacttgccaagtttccaagat
ggctcgattattgcaccagacaaaatttcacaaaatttaagtaaaattccgccgttgcaa
cttattgaaattatatcaaatttgaaaatattatcaaaccaagaaaacatccaaaaatcg
caattagaatctttcttagatactaacagtgatatcacaatatcagtgacccaagcccta
ctagaaatgggatttatagactacagcgtggtgactaaagtgttgaaatcccaagttggc
gaggccccatctttgctttcgagtaataacacaagtaattcgaacacccccgtaagcgta
attagaaataacactccgttgcatgtaccttctaatgaagtcagcaacaatcctaacaat
atgccactgaacgtagctatgccaatgcctatgtcgacaccaccatttatccctttacct
ctgcaacaacaaccgttcggttttgcgccaccgggccctttcatgcctccagctcaaggc
ccctccatgggacagcctgtgttggcaaatcaactcggccaggtccagcaacaaaatata
agttctacagaaggaccctctaacgcgaataaagcgaatgacagcggcaccattaatatg
gcgaaactgcaattactacctgaaaaccaacaagatatgatcaaacaagttcttactttg
acacctgcccagatccaaagtttaccaagtgaccagcaacttatggtggaaaactttaga
aaagaatatataatctaa

DBGET integrated database retrieval system