KEGG   Saccharomyces cerevisiae (budding yeast): YGR158CHelp
Entry
YGR158C           CDS       T00005                                 

Gene name
MTR3
Definition
(RefSeq) exosome non-catalytic core subunit MTR3
  KO
K12587  exosome complex component MTR3
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03018  RNA degradation
Module
sce_M00391  Exosome, eukaryotes
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    YGR158C (MTR3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sce03019]
    YGR158C (MTR3)
Messenger RNA biogenesis [BR:sce03019]
 Eukaryotic Type
  mRNA degradation factors
   3'-5' decay
    Core exosome factors
     YGR158C (MTR3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNase_PH
Motif
Other DBs
NCBI-GeneID: 853062
NCBI-ProteinID: NP_011674
SGD: S000003390
UniProt: P48240
Structure
PDB: 

Position
VII:complement(805269..806021)
Genome map
AA seq 250 aa AA seqDB search
MNVQDRRRLLGPAAAKPMAFSNTTTHVPEKKSTDLTPKGNESEQELSLHTGFIENCNGSA
LVEARSLGHQTSLITAVYGPRSIRGSFTSQGTISIQLKNGLLEKYNTNELKEVSSFLMGI
FNSVVNLSRYPKSGIDIFVYLTYDKDLTNNPQDDDSQSKMMSSQISSLIPHCITSITLAL
ADAGIELVDMAGAGEANGTVVSFIKNGEEIVGFWKDDGDDEDLLECLDRCKEQYNRYRDL
MISCLMNQET
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgaatgttcaagacagaaggaggttattaggccctgctgctgccaagccaatggcgttt
agcaacactactactcatgtgccagaaaagaaatcaacagatttgacacctaaaggcaat
gaaagtgaacaggaactttctctacataccggtttcatcgaaaactgcaatggatctgca
ttagtagaagctagaagcttaggacaccaaacatcgctcattaccgctgtctatggacca
cgctccattagaggatccttcacatctcaaggtactatatctattcagttaaagaacggt
cttctggaaaaatataacacaaatgaactgaaggaagttagcagctttttaatgggcatt
ttcaattcagtagtaaacctatctcgctaccccaagtccggcatcgatatcttcgtttat
ttaacgtatgataaggatcttacaaataatcctcaggacgacgattcgcaaagcaaaatg
atgtcttctcaaatatcatctctcataccacattgtatcactagtataacgctagcctta
gctgatgccggcatcgaattagtggatatggcaggtgccggtgaggccaatggcactgtc
gtatcattcatcaaaaatggagaggaaattgtaggtttttggaaggatgatggtgacgat
gaagatcttttggaatgccttgatcgttgcaaggagcaatataaccgttatagagattta
atgataagctgtttaatgaaccaggaaacttag

DBGET integrated database retrieval system