KEGG   Saccharomyces cerevisiae (budding yeast): YGR169CHelp
Entry
YGR169C           CDS       T00005                                 

Gene name
PUS6
Definition
(RefSeq) pseudouridine synthase PUS6
  KO
K15453  tRNA pseudouridine31 synthase [EC:5.4.99.42]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sce03016]
    YGR169C (PUS6)
Enzymes [BR:sce01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.42  tRNA pseudouridine31 synthase
     YGR169C (PUS6)
Transfer RNA biogenesis [BR:sce03016]
 Eukaryotic Type
  tRNA modification factors
   Psudouridine synthases
    YGR169C (PUS6)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-GeneID: 853079
NCBI-ProteinID: NP_011685
SGD: S000003401
UniProt: P53294
Position
VII:complement(834689..835903)
Genome map
AA seq 404 aa AA seqDB search
MSTIKVIEVYTQNGLRKVRPYYNRRSAFVKGRWLGKLLIDVLVSEFKLRPRAYYLDQIRK
GTYRLIRDGVPLVPDHLMTTIIKNHDVLETTTHKHEPPVKQWCSQEVEAEDLPGRIAGFN
IVFEDESILVIDKPSGIPVHPTGQFYQNTITELLKLHGVDALPCYRLDKITSGLLILAKN
SQSAGEIQKSIRSRDMIKIYLARVKGRFPHSELILDNENAAETTFEDTSKVTVEMTPIYS
IDPKRQFPVGLSTSKDAITKFYPIRYFSHADETVVACKPITGRTHQIRIHLARLGHPIVN
DSVYCSHITKYPERLKFITQFPRWENQQDLDAEELKVRFQKFVDETKNNCRTMETFCPEC
HTVDLKDPVLSDLELWLHAWKYEEINGKFKFKTDLPKWAQLDNS
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgtcaactatcaaagttattgaggtatatacacagaatggactgagaaaggtacggccc
tattataacagaagatcagcgttcgtgaaggggcgctggttgggtaagttactaatagac
gttctcgttagtgaatttaaacttcgcccaagagcttattatttggaccaaataaggaaa
ggcacatataggttgatccgagatggtgtgccgctggtaccagatcatctcatgactacc
ataatcaagaatcatgatgttttagaaacaactacgcataagcacgaaccgccggtaaaa
caatggtgtagccaggaagttgaagcggaggatttacctggcagaatagcgggattcaat
attgtttttgaagatgagagtatcctcgtcattgataaacccagtggtataccagtgcat
ccaaccggtcagttttaccagaacacaattactgaattactgaagttacatggtgtagat
gctcttccttgttatcggttagacaagatcacatcaggcttgttgatattggccaagaac
agtcagagtgcgggggaaatccagaagagtattcgttcaagagatatgattaagatctac
ttggcaagggtcaagggaagatttcctcactccgaattgatattggacaatgaaaatgcg
gcggaaacgacttttgaggacacttccaaagttacagtggaaatgacacccatatattct
atcgatccaaagagacagtttccagttggtttatcgacatcgaaggatgctattaccaag
ttctacccaataagatacttctctcatgctgatgaaactgtcgtcgcttgtaagccaata
actggaagaacacaccaaattcgaatccatttagctaggctcggtcatcccatcgtcaac
gatagtgtttattgttcgcatattacaaaataccccgaaaggcttaagtttataactcag
tttcctagatgggagaatcagcaggatttagatgctgaggaattgaaagtgaggtttcaa
aaatttgtcgatgagacaaaaaataattgtcggacaatggaaacattttgtcctgaatgt
catactgttgatttaaaggatcctgtgctatcagacctagaattatggttgcatgcttgg
aagtatgaggagattaatggcaaattcaagttcaaaacagatttaccaaaatgggcacaa
ttggacaatagttaa

DBGET integrated database retrieval system