KEGG   Saccharomyces cerevisiae (budding yeast): YGR183CHelp
Entry
YGR183C           CDS       T00005                                 

Gene name
QCR9, UCR9
Definition
(RefSeq) ubiquinol--cytochrome-c reductase subunit 9
  KO
K00419  ubiquinol-cytochrome c reductase subunit 9
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00190  Oxidative phosphorylation
sce01100  Metabolic pathways
Module
sce_M00152  Cytochrome bc1 complex
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    YGR183C (QCR9)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UCR_UQCRX_QCR9 DUF2976
Motif
Other DBs
NCBI-GeneID: 853095
NCBI-ProteinID: NP_011699
SGD: S000003415
UniProt: P22289
Structure
PDB: 

Position
VII:complement(join(859063..859260,859474..859476))
Genome map
AA seq 66 aa AA seqDB search
MSFSSLYKTFFKRNAVFVGTIFAGAFVFQTVFDTAITSWYENHNKGKLWKDVKARIAAGD
GDDDDE
NT seq 201 nt NT seq  +upstreamnt  +downstreamnt
atgtctttttcatcactatataaaacctttttcaaacgaaacgctgtttttgttggtact
atctttgcaggtgcctttgttttccaaactgtatttgatactgctattacttcatggtac
gagaatcacaacaaaggaaaattatggaaagatgtcaaggctcgaatagctgcaggcgat
ggagacgacgatgatgagtaa

DBGET integrated database retrieval system