KEGG   Saccharomyces cerevisiae (budding yeast): YGR191W
Entry
YGR191W           CDS       T00005                                 
Symbol
HIP1
Name
(RefSeq) histidine permease
  KO
K16261  yeast amino acid transporter
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sce02000]
    YGR191W (HIP1)
Transporters [BR:sce02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   YGR191W (HIP1)
SSDB
Motif
Pfam: AA_permease AA_permease_2
Other DBs
NCBI-GeneID: 853104
NCBI-ProteinID: NP_011707
SGD: S000003423
UniProt: P06775
Position
VII:880420..882231
AA seq 603 aa
MPRNPLKKEYWADVVDGFKPATSPAFENEKESTTFVTELTSKTDSAFPLSSKDSPGINQT
TNDITSSDRFRRNEDTEQEDINNTNLSKDLSVRHLLTLAVGGAIGTGLYVNTGAALSTGG
PASLVIDWVIISTCLFTVINSLGELSAAFPVVGGFNVYSMRFIEPSFAFAVNLNYLAQWL
VLLPLELVAASITIKYWNDKINSDAWVAIFYATIALANMLDVKSFGETEFVLSMIKILSI
IGFTILGIVLSCGGGPHGGYIGGKYWHDPGAFVGHSSGTQFKGLCSVFVTAAFSYSGIEM
TAVSAAESKNPRETIPKAAKRTFWLITASYVTILTLIGCLVPSNDPRLLNGSSSVDAASS
PLVIAIENGGIKGLPSLMNAIILIAVVSVANSAVYACSRCMVAMAHIGNLPKFLNRVDKR
GRPMNAILLTLFFGLLSFVAASDKQAEVFTWLSALSGLSTIFCWMAINLSHIRFRQAMKV
QERSLDELPFISQTGVKGSWYGFIVLFLVLIASFWTSLFPLGGSGASAESFFEGYLSFPI
LIVCYVGHKLYTRNWTLMVKLEDMDLDTGRKQVDLTLRREEMRIERETLAKRSFVTRFLH
FWC
NT seq 1812 nt   +upstreamnt  +downstreamnt
atgcctagaaacccattgaaaaaggaatattgggcagatgtagttgacggattcaagccg
gctacttctccagccttcgagaatgaaaaagaatctactacatttgttaccgaactaact
tccaaaaccgattctgcatttccattaagtagcaaggattcacctggcataaaccaaacc
acaaacgatattacctcttcagatcgcttccgtcgtaatgaagacacagagcaggaagac
atcaacaacaccaacctgagtaaagatctatccgtgagacatcttttaactctagctgtc
gggggtgcaataggtactggtttatatgtgaatacgggtgctgctttatctacaggtggt
ccggccagtttagttattgattgggttattatcagtacatgtctttttactgtgattaac
tctcttggtgagctgtccgctgcttttcccgttgttggtgggttcaatgtttacagtatg
cgttttattgagccttcatttgcattcgcagtgaacttaaactatttagcacaatggcta
gttcttctacccttggaattagtggccgcatctattactataaaatactggaatgataaa
attaattccgacgcctgggttgctatcttttatgccaccattgcactggctaatatgttg
gatgttaagtcatttggtgagaccgaatttgtattgtccatgattaaaatcctctccatc
attggctttactatcttaggtattgttttgtcctgtggtggtgggcctcacggcggttac
attggtggtaaatactggcatgacccaggcgcttttgtagggcacagctcgggaactcag
tttaaaggtttatgttcagtttttgttaccgctgccttttcttattccggtattgaaatg
actgctgtctccgctgctgaaagtaaaaatccaagagaaaccattcccaaggcagcaaag
agaactttttggctgattaccgcctcttatgtgactatattgactttgattggttgcttg
gttccatccaatgaccctaggttactaaacggttcaagttcagtggacgctgcctcatct
cctctggttatcgcaattgaaaacgggggtattaaaggtctaccatcattaatgaacgcc
attattttgattgctgttgtttccgtggctaacagtgctgtttatgcatgttcaaggtgt
atggtcgccatggctcatattggtaatttaccaaaatttttgaaccgtgttgacaaaagg
ggtagaccaatgaatgctatcttgttaactttgttttttggtttgctttcctttgtggca
gcaagtgataagcaagctgaagtctttacatggttgagtgccttatctggtttatcgaca
attttctgctggatggccattaatctttcccatattagatttcgccaagccatgaaagtt
caagaaaggtctttagacgaattacccttcatttctcaaactggcgtcaagggatcctgg
tatggttttatcgttttatttctggttcttatagcatcgttttggacttctctgttccca
ttaggcggttcaggagccagcgcagaatcattctttgaaggatacttatcctttccaatt
ttgattgtctgttacgttggacataaactgtatactagaaattggactttgatggtgaaa
ctagaagatatggatcttgataccggcagaaaacaagtagatttgactcttcgtagggaa
gaaatgaggattgagcgagaaacattagcaaaaagatccttcgtaacaagatttttacat
ttctggtgttga

DBGET integrated database retrieval system