KEGG   Saccharomyces cerevisiae (budding yeast): YGR194C
Entry
YGR194C           CDS       T00005                                 

Gene name
XKS1
Definition
(RefSeq) xylulokinase
  KO
K00854  xylulokinase [EC:2.7.1.17]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00040  Pentose and glucuronate interconversions
sce01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    YGR194C (XKS1)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.17  xylulokinase
     YGR194C (XKS1)
SSDB
Motif
Pfam: FGGY_N FGGY_C
Other DBs
NCBI-GeneID: 853108
NCBI-ProteinID: NP_011710
SGD: S000003426
UniProt: P42826
Position
VII:complement(886073..887875)
AA seq 600 aa
MLCSVIQRQTREVSNTMSLDSYYLGFDLSTQQLKCLAINQDLKIVHSETVEFEKDLPHYH
TKKGVYIHGDTIECPVAMWLEALDLVLSKYREAKFPLNKVMAVSGSCQQHGSVYWSSQAE
SLLEQLNKKPEKDLLHYVSSVAFARQTAPNWQDHSTAKQCQEFEECIGGPEKMAQLTGSR
AHFRFTGPQILKIAQLEPEAYEKTKTISLVSNFLTSILVGHLVELEEADACGMNLYDIRE
RKFSDELLHLIDSSSKDKTIRQKLMRAPMKNLIAGTICKYFIEKYGFNTNCKVSPMTGDN
LATICSLPLRKNDVLVSLGTSTTVLLVTDKYHPSPNYHLFIHPTLPNHYMGMICYCNGSL
ARERIRDELNKERENNYEKTNDWTLFNQAVLDDSESSENELGVYFPLGEIVPSVKAINKR
VIFNPKTGMIEREVAKFKDKRHDAKNIVESQALSCRVRISPLLSDSNASSQQRLNEDTIV
KFDYDESPLRDYLNKRPERTFFVGGASKNDAIVKKFAQVIGATKGNFRLETPNSCALGGC
YKAMWSLLYDSNKIAVPFDKFLNDNFPWHVMESISDVDNENWDRYNSKIVPLSELEKTLI
NT seq 1803 nt   +upstreamnt  +downstreamnt
atgttgtgttcagtaattcagagacagacaagagaggtttccaacacaatgtctttagac
tcatactatcttgggtttgatctttcgacccaacaactgaaatgtctcgccattaaccag
gacctaaaaattgtccattcagaaacagtggaatttgaaaaggatcttccgcattatcac
acaaagaagggtgtctatatacacggcgacactatcgaatgtcccgtagccatgtggtta
gaggctctagatctggttctctcgaaatatcgcgaggctaaatttccattgaacaaagtt
atggccgtctcagggtcctgccagcagcacgggtctgtctactggtcctcccaagccgaa
tctctgttagagcaattgaataagaaaccggaaaaagatttattgcactacgtgagctct
gtagcatttgcaaggcaaaccgcccccaattggcaagaccacagtactgcaaagcaatgt
caagagtttgaagagtgcataggtgggcctgaaaaaatggctcaattaacagggtccaga
gcccattttagatttactggtcctcaaattctgaaaattgcacaattagaaccagaagct
tacgaaaaaacaaagaccatttctttagtgtctaattttttgacttctatcttagtgggc
catcttgttgaattagaggaggcagatgcctgtggtatgaacctttatgatatacgtgaa
agaaaattcagtgatgagctactacatctaattgatagttcttctaaggataaaactatc
agacaaaaattaatgagagcacccatgaaaaatttgatagcgggtaccatctgtaaatat
tttattgagaagtacggtttcaatacaaactgcaaggtctctcccatgactggggataat
ttagccactatatgttctttacccctgcggaagaatgacgttctcgtttccctaggaaca
agtactacagttcttctggtcaccgataagtatcacccctctccgaactatcatcttttc
attcatccaactctgccaaaccattatatgggtatgatttgttattgtaatggttctttg
gcaagggagaggataagagacgagttaaacaaagaacgggaaaataattatgagaagact
aacgattggactctttttaatcaagctgtgctagatgactcagaaagtagtgaaaatgaa
ttaggtgtatattttcctctgggggagatcgttcctagcgtaaaagccataaacaaaagg
gttatcttcaatccaaaaacgggtatgattgaaagagaggtggccaagttcaaagacaag
aggcacgatgccaaaaatattgtagaatcacaggctttaagttgcagggtaagaatatct
cccctgctttcggattcaaacgcaagctcacaacagagactgaacgaagatacaatcgtg
aagtttgattacgatgaatctccgctgcgggactacctaaataaaaggccagaaaggact
ttttttgtaggtggggcttctaaaaacgatgctattgtgaagaagtttgctcaagtcatt
ggtgctacaaagggtaattttaggctagaaacaccaaactcatgtgcccttggtggttgt
tataaggccatgtggtcattgttatatgactctaataaaattgcagttccttttgataaa
tttctgaatgacaattttccatggcatgtaatggaaagcatatccgatgtggataatgaa
aattgggatcgctataattccaagattgtccccttaagcgaactggaaaagactctcatc
taa

DBGET integrated database retrieval system