KEGG   Saccharomyces cerevisiae (budding yeast): YGR195W
Entry
YGR195W           CDS       T00005                                 

Gene name
SKI6, ECM20, RRP41
Definition
(RefSeq) exosome non-catalytic core subunit SKI6
  KO
K11600  exosome complex component RRP41
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    YGR195W (SKI6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sce03019]
    YGR195W (SKI6)
Messenger RNA biogenesis [BR:sce03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    Core exosome factors
     YGR195W (SKI6)
 Prokaryotic type
  Archeal mRNA degradation factors
   Exosome components
    Cofactors
     YGR195W (SKI6)
SSDB
Motif
Pfam: RNase_PH RNase_PH_C
Other DBs
NCBI-GeneID: 853109
NCBI-ProteinID: NP_011711
SGD: S000003427
UniProt: P46948
Structure
PDB: 

Position
VII:888882..889622
AA seq 246 aa
MSRLEIYSPEGLRLDGRRWNELRRFESSINTHPHAADGSSYMEQGNNKIITLVKGPKEPR
LKSQMDTSKALLNVSVNITKFSKFERSKSSHKNERRVLEIQTSLVRMFEKNVMLNIYPRT
VIDIEIHVLEQDGGIMGSLINGITLALIDAGISMFDYISGISVGLYDTTPLLDTNSLEEN
AMSTVTLGVVGKSEKLSLLLVEDKIPLDRLENVLAIGIAGAHRVRDLMDEELRKHAQKRV
SNASAR
NT seq 741 nt   +upstreamnt  +downstreamnt
atgtcaagactagaaatatactcgccagaagggctacgtctcgatggacgtcgatggaat
gaactccgccgttttgaaagttccatcaacacacatccgcacgctgcagacggttcatcc
tacatggaacaaggtaacaacaaaattatcactcttgttaaaggtccaaaagagccaaga
ttgaaatctcaaatggatacctcaaaggctttattgaacgtatcggtaaacattacaaaa
ttctccaaattcgaaagaagtaaatcaagccacaagaatgaaaggcgtgttcttgagata
caaacctccctggtgaggatgtttgagaagaatgtcatgctgaatatctaccccagaaca
gttatcgatatcgagatccatgtccttgagcaagatggcggtattatgggatctttaatc
aacggtattaccctcgctttaatagatgccggtatatcaatgttcgattacataagtggt
atatccgtcgggctgtacgatactaccccattattagataccaattcattagaagaaaat
gctatgagtacagtgacactaggtgtggtagggaagtcagaaaaactttctcttttattg
gtggaagacaaaattccgttagataggttagagaacgttcttgccatcggcatcgcaggt
gctcatagggtaagagatttgatggatgaagaactgaggaaacatgctcagaaaagagtc
agtaacgcctctgctaggtag

DBGET integrated database retrieval system