KEGG   Saccharomyces cerevisiae (budding yeast): YGR200CHelp
Entry
YGR200C           CDS       T00005                                 

Gene name
ELP2, KTI3, TOT2
Definition
(RefSeq) Elongator subunit ELP2
  KO
K11374  elongator complex protein 2
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sce03016]
    YGR200C (ELP2)
   03036 Chromosome and associated proteins [BR:sce03036]
    YGR200C (ELP2)
Transfer RNA biogenesis [BR:sce03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    YGR200C (ELP2)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic Type
  Histone modification proteins
   HAT complexes
    Elongator complex
     YGR200C (ELP2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: WD40 ANAPC4_WD40 Nup160
Motif
Other DBs
NCBI-GeneID: 853114
NCBI-ProteinID: NP_011716
SGD: S000003432
UniProt: P42935
Structure
PDB: 

Position
VII:complement(899904..902270)
Genome map
AA seq 788 aa AA seqDB search
MVECITPEAIFIGANKQTQVSDIHKVKKIVAFGAGKTIALWDPIEPNNKGVYATLKGHEA
EVTCVRFVPDSDFMVSASEDHHVKIWKFTDYSHLQCIQTIQHYSKTIVALSALPSLISVG
CADGTISIWRQNIQNDEFGLAHEFTIKKGFFYPLCLSLSKVEEKKYLLAIGGTNVNVFIA
SFILSDSGIEKCRVVAELEGHEDWVKSLAFRHQETPGDYLLCSGSQDRYIRLWRIRINDL
IDDSEEDSKKLTLLSNKQYKFQIDDELRVGINFEALIMGHDDWISSLQWHESRLQLLAAT
ADTSLMVWEPDETSGIWVCSLRLGEMSSKGASTATGSSGGFWSCLWFTHERMDFFLTNGK
TGSWRMWATKDNIICDQRLGISGATKDVTDIAWSPSGEYLLATSLDQTTRLFAPWIYDAS
GRKREIATWHEFSRPQIHGYDMICVETVTDTRFVSGGDEKILRSFDLPKGVAGMLQKFVG
IQFEEKSEMPDSATVPVLGLSNKAGEDDANEDDEEEEGGNKETPDITDPLSLLECPPMED
QLQRHLLWPEVEKLYGHGFEITCLDISPDQKLIASACRSNNVQNAVIRIFSTENWLEIKP
ALPFHSLTITRLKFSKDGKFLLSVCRDRKWALWERNMEDNTFELRFKNEKPHTRIIWDAD
WAPLEFGNVFVTASRDKTVKVWRHQKEPADDYVLEASIKHTKAVTAISIHDSMIREKILI
SVGLENGEIYLYSYTLGKFELITQLNEDITPADKITRLRWSHLKRNGKLFLGVGSSDLST
RIYSLAYE
NT seq 2367 nt NT seq  +upstreamnt  +downstreamnt
atggtggaatgtatcactcccgaagccatttttataggtgctaacaagcaaactcaggtt
agcgatatacacaaagttaaaaaaatcgtcgcatttggcgcaggtaaaactattgcatta
tgggaccccattgaaccaaataataaaggtgtttatgcaactttgaaaggccacgaagct
gaagtgacttgtgtcagatttgtcccagattcagattttatggtatctgcatctgaggat
catcatgttaagatctggaaatttactgattactcacatttacaatgtattcaaaccatt
caacattactcgaagacgattgtggcattaagcgctttaccaagtcttatttcagtcggt
tgtgctgatggtactatcagcatatggagacaaaatattcaaaatgatgagtttggtctt
gctcatgaattcaccataaaaaagggattcttctatccactgtgtttatcactgtcaaaa
gttgaagaaaaaaagtatttacttgccattgggggtactaatgtgaacgtttttatcgca
tctttcattttaagtgattctggcattgagaagtgtcgagtggttgcagaattggaaggt
catgaagactgggtcaagtcattggctttccgtcaccaggaaactccgggtgattatttg
ttatgctctggctctcaggaccgttatattagattgtggagaattaggattaacgattta
atcgatgactctgaagaagattcaaagaaattaacattattgagcaataaacaatataaa
tttcaaattgatgatgaattgagagtaggcataaattttgaagccttaattatgggccat
gatgattggatttcatcccttcagtggcacgaaagtcgcttacaactactagctgctact
gctgatacttcattgatggtatgggaacctgatgagacttcaggcatttgggtgtgcagt
ctacggttaggagaaatgtcctcaaaaggtgcctcaactgcaacgggttcctctggaggt
ttttggtcctgtctatggtttactcatgagagaatggatttctttttgaccaatggtaag
actgggtcctggaggatgtgggctacaaaggataatattatttgcgatcaaaggttgggc
atatccggtgccacgaaggatgtgacggacattgcttggtctcctagcggcgagtaccta
ttggctacttctctggatcagaccactagactctttgctccatggatttatgatgccagc
gggagaaaaagggaaatagctacctggcatgaattttctaggccacaaatacatggttat
gatatgatttgtgttgagacagtgacggataccagatttgtaagtggtggtgatgaaaaa
atcttgagatcatttgacctacctaaaggggtggcaggaatgttacaaaagtttgttggt
attcaatttgaggaaaaaagtgaaatgccagactctgctaccgttcctgtgttaggtttg
tctaataaagctggtgaggatgacgcaaatgaagatgatgaagaggaggaaggtggtaat
aaagaaacaccagatatcactgatccattgtccttgctagaatgtccacctatggaagac
caattgcaaagacacttgttatggcctgaagtggaaaagctttacggacatggttttgaa
ataacgtgtcttgatatttctccggatcagaaattaattgcttctgcttgtagatcaaat
aatgttcagaatgcagttattagaatattcagcacagaaaattggttagaaataaagcct
gcattaccgttccacagtctaacgataacaagattaaaattctctaaagatggaaaattt
ttattgagtgtttgtagagacagaaaatgggcgctttgggaaagaaatatggaagataat
acttttgaattgagattcaaaaatgaaaaaccacacacaaggattatatgggatgcagac
tgggcaccattagagtttggtaatgtttttgtcaccgcgtccagggataaaactgtcaaa
gtatggaggcaccaaaaggagccagctgatgactacgttctggaagcatcaattaaacac
actaaagctgtcactgctatttccatacatgacagcatgataagagagaaaattttgata
tcggtgggtcttgaaaacggtgagatttatttatacagttatactttgggaaagtttgag
ttaataacgcagctaaacgaggatataacaccagcagacaaaattacaagattgaggtgg
tcacatttaaagagaaacggtaaattatttttaggtgtaggaagtagtgatttgtccacc
cgtatatactcattagcatatgaatag

DBGET integrated database retrieval system