KEGG   Saccharomyces cerevisiae (budding yeast): YGR224W
Entry
YGR224W           CDS       T00005                                 
Symbol
AZR1
Name
(RefSeq) azole transporter
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB
Motif
Pfam: MFS_1 TRI12 Pam17
Other DBs
NCBI-GeneID: 853139
NCBI-ProteinID: NP_011740
SGD: S000003456
UniProt: P50080
Position
VII:942806..944647
AA seq 613 aa
MKGEPKTYSMSDLSYYGEKAQQQNEKQQKQYVVRRNSTQSTSKQNVSVVLEDNASESNEL
PKGFILYASLIALALSLFLAALDIMIVSTIIEEVAKQFGSYSEIGWLFTGYSLPNALLAL
IWGRIATPIGFKETMLFAIVIFEIGSLISALANSMSMLIGGRVIAGVGGCGIQSLSFVIG
STLVEESQRGILIAVLSCSFAIASVVGPFLGGVFTSSVTWRWCFYVNLPIGGLAFFLFLF
FYNPGLSTFQETMDNIRKFPSQFIEIVRNVAYHLLKIKGFSKLNGWRKPFMELIFMYDII
EFVFCSAGFTCILLAFTFGGNRYAWNSASIIILFIIGIVLVVLAGIYDFLVFPKFNIVKA
TPHYQPLMSWTNIKKPGIFTVNIALFLTCAGYISQFTYIVQYFQLIYNDSAWRAAVHLVA
CIISTVVTAILCGAITDKTRQIKPIIVISSIFGVVGAGILTLLNNNANNSAHIGLLILPG
VAFGGLAQSSMLASQIQLDKKSPTFRSDFVSITTFNTFCKNLGQALGGVISNTVFSAAAI
KKLTKANIQLPDGTTVDNLVIYRQTNFDGSHSKLGNIISESLTDVFYMALGFYALSLIFA
VFASNKKVTASLR
NT seq 1842 nt   +upstreamnt  +downstreamnt
atgaaaggcgaacctaagacttacagcatgagcgacctctcatactacggtgagaaagca
caacaacagaacgagaaacagcaaaaacaatatgttgtgagacgaaattctacgcagtca
acatcaaaacaaaacgtgagcgtggtgctcgaggacaacgccagcgaaagtaatgaacta
cctaaagggtttatcttgtacgcatctttgatagcattggctttgtcgctgtttctggca
gccttggatatcatgatagtttctacaatcattgaagaagtagctaaacagtttggatcg
tactctgagatcgggtggttatttaccgggtatagcttaccaaacgctctgttggcgttg
atatggggaagaattgccacacctatcggattcaaggagaccatgctatttgctattgtc
atttttgaaatcgggtcgctgatctctgctttagcaaattcaatgagtatgctcattggt
ggtagagttattgctggagtcggcggttgtggtattcaaagtttatcgttcgtcattggt
tcaaccctggtagaggagtcgcagagaggcatactaattgctgttttgagttgttcgttt
gctattgcatctgttgttgggcctttccttggaggagttttcacctccagcgtcacatgg
agatggtgcttctatgttaatttaccgatcggtggcctagcatttttcttattcctgttc
ttttataacccaggtttaagtacatttcaagagacaatggataacatccgcaaatttcca
tcacagtttatcgaaattgttcggaatgtagcatatcatttattgaaaatcaaagggttt
agcaaacttaatgggtggagaaagccgttcatggaattgattttcatgtatgatattatc
gagtttgtgttttgttcagctggattcacatgtattctattggctttcacatttggcggt
aaccggtatgcttggaactctgcatccatcattattcttttcatcatcggtatagtcctg
gtagtgttagcaggtatctatgatttccttgtcttccccaaatttaatatagtgaaagca
acaccacattaccaaccattaatgtcatggacaaatatcaagaaaccaggtattttcacg
gttaatatagccttgtttctcacttgtgcaggatatatcagtcagtttacgtatattgtg
caatacttccaattaatttacaatgattccgcctggagagccgctgtacacctggttgct
tgcattatttctacagtcgttacagcaatactttgcggtgctatcaccgacaaaacccgc
caaatcaaaccgattattgttatttcaagcatttttggtgttgttggtgcgggtatatta
accctattgaacaataatgccaataactctgctcacatcggccttttgatattacctggc
gttgctttcggtggtttggcacaaagttccatgctcgcttctcaaattcagttagacaag
aagagcccaacttttcgatcagattttgtctctattaccacttttaacacattttgcaaa
aatctaggtcaagcactgggaggtgtcatctctaacactgttttcagtgctgctgctatc
aagaaattaaccaaggctaatattcagctcccagatggtaccacggtagacaatctggta
atctataggcagaccaatttcgatggctctcattccaaattgggcaatataatttctgaa
tctctcactgacgtcttttacatggcattaggattttatgcattatctctcatttttgct
gtttttgcttcaaataagaaagtcacagcaagcctgagataa

DBGET integrated database retrieval system