KEGG   Saccharomyces cerevisiae (budding yeast): YGR249W
Entry
YGR249W           CDS       T00005                                 

Gene name
MGA1
Definition
(RefSeq) Mga1p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB
Motif
Pfam: HSF_DNA-bind KTI12 FapA DUF2205
Other DBs
NCBI-GeneID: 853164
NCBI-ProteinID: NP_011765
SGD: S000003481
UniProt: P53050
Position
VII:988049..989419
AA seq 456 aa
MQPKTFVHQLHAILLEPEVNKWIYWSPTDNTVFFLKPYDPNFSTHVLKRYFKHGNVNSFV
RQLHMYGFHKLSHPSPDQSSANNGNVKELVEWKFTHPSGFFFKEANAGILNKIQRKSTGV
GKDGKRKNILSPISVSYVDASRLNVLSQQSGPVSAREPSNMFMGSPVHYSTSQSPPHISI
PQQQQSSGPYLISSLPPQQPTVNMMRRQSISARMMNSYDYPNQFSTQDSIVQPQQPQQVL
SPQALSGPPMKKSGTLSSTDDLKTTSLPIVNYPMPYHPGAFAQQQQQQQQPLPTVPPYSS
YSTPFPSMMNSLSNSASNSPALGVCNNNVTLPKKSNISERQALDNHIQTLKNSLSTITDL
IEKHINSASQDENKTLTNDAMNKDLRTSLSLLQNSKEEIIQLESKWMSMQSVKTTALPLQ
ETTNTSSTLTSLTSSIIPKSIPIITKGEVATKPASY
NT seq 1371 nt   +upstreamnt  +downstreamnt
atgcaacctaaaactttcgtccaccaacttcatgcaattcttctggaaccggaagtaaat
aaatggatatactggtctccgactgataacacggtattttttttgaagccatatgaccct
aattttagtacacatgttctgaagcgttatttcaaacatggaaatgtcaatagttttgtt
cgtcaactacacatgtacgggtttcataaactatctcatccttccccagaccaatcttct
gccaacaatggtaacgttaaagaacttgttgaatggaaatttacccacccatctggattc
ttcttcaaagaggccaacgccggtatcttgaataaaatccaaagaaagagcactggtgtg
ggaaaagatggtaaaagaaagaatatactgtcaccaatatctgtcagttacgttgatgct
tcgaggttaaatgttctctctcagcaatccggaccagtttctgcaagagaaccatcaaac
atgtttatgggcagtcccgtccattactcaacatcccaaagtcctccacatatcagtata
ccgcaacagcaacaaagtagtggaccttacctaatatcttcactgccccctcaacaaccc
acggtgaacatgatgcgaaggcaaagcatctcggcgaggatgatgaattcttatgactat
cccaatcaattttccacccaagatagcatagtccagcctcagcagccgcaacaagtactt
tctccacaagcattatctggacctccgatgaagaaatcaggaacactatcttcgacagat
gatctgaaaacaacttccttgccaattgttaattacccaatgccgtatcatcctggagct
tttgcccagcagcagcagcagcagcagcaaccgctccctacagtcccgccatatagcagt
tactccactccatttccctcaatgatgaactctctttcgaactctgcttctaactcacct
gctttaggagtttgtaataataatgtaacactacccaaaaaaagcaatataagtgaaagg
caagctttggataaccatatacaaactttaaagaactctctatcaacaatcactgatttg
atagaaaaacatattaacagcgcatcgcaagatgaaaataaaactctaactaatgatgcc
atgaacaaagaccttcgaacaagcttatccctattacagaattccaaggaggaaatcatt
caacttgaaagtaaatggatgtctatgcaatctgttaaaacaactgccctaccccttcaa
gagactacgaatacatcatcgaccttaacttctctgacgtccagcataattcccaagagt
atacctataatcacgaaaggtgaagtcgccactaaaccagcatcttactga

DBGET integrated database retrieval system