KEGG   Saccharomyces cerevisiae (budding yeast): YGR270WHelp
Entry
YGR270W           CDS       T00005                                 

Gene name
YTA7
Definition
(RefSeq) Yta7p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA AAA_lid_3 AAA_2 AAA_16 IstB_IS21 AAA_5 Bromodomain Sigma54_activ_2 ResIII AAA_14 TIP49 AAA_22 Sigma54_activat AAA_33 RNA_helicase AAA_7 AAA_18 ABC_tran Mg_chelatase AAA_3 RuvB_N AAA_25 AAA_30
Motif
Other DBs
NCBI-GeneID: 853186
NCBI-ProteinID: NP_011786
SGD: S000003502
UniProt: P40340
Position
VII:1027370..1031509
Genome map
AA seq 1379 aa AA seqDB search
MARNLRNRRGSDVEDASNAKVGYETQIKDENGIIHTTTRSLRKINYAEIEKVFDFLEDDQ
VMDKDETPVDVTSDEHHNNNQKGDDEDDDVDLVSPHENARTNEELTNERNLRKRKAHDPE
EDDESFHEEDVDDDEEEEEADEFEDEYLDEDSKDNNRRRRAADRKFVVPDPDDDEEYDED
DEEGDRISHSASSKRLKRANSRRTRSSRHPETPPPVRRALRSRTRHSRTSNEENDDENDN
SRNEALTLADEIRELQEDSPIREKRFLRERTKPVNYKLPPPLTASNAEEFIDKNNNALSF
HNPSPARRGRGGWNASQNSGPTRRLFPTGGPFGGNDVTTIFGKNTNFYNQVPSAFSDNNN
NKLILDSDSSDDEILPLGVTPKTKKENTQKKKKKKPEIADLDPLGVDMNVNFDDIGGLDN
YIDQLKEMVALPLLYPELYQNFNITPPRGVLFHGPPGTGKTLMARALAASCSSDERKITF
FMRKGADILSKWVGEAERQLRLLFEEAKKHQPSIIFFDEIDGLAPVRSSKQEQIHASIVS
TLLALMDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFPLPDVKARFKILQIQTR
KWSSPLSTNFIDKLAFLTKGYGGADLRSLCTEAALISIQRSFPQIYRSNDKLLVDPSKIK
VKVSDFMLALKKIVPSSARSTGSSPQPLPELIKPLLADQLNNLKNKLDYMLNIKDTTFQR
NTSLLQNFIDYEEYSGEEEEHDKYGGNEDTSSFRSYEFFESMAESQICKPRLLINGPKGN
GQQYVGAAILNYLEEFNVQNLDLASLVSESSRTIEAAVVQSFMEAKKRQPSVVFIPNLDI
WINTIPENVILVLSGLFRSLQSNEKILLLCLAENLDISEVKNGILSDFAFDKNIFQLHKP
SKENITRYFSNLIELLKTKPSDIPMKKRRVKPLPELQKVTSNAAPTNFDENGEPLSEKVV
LRRKLKSFQHQDMRLKNVLKIKLSGLMDLFKNRYKRFRKPPIDDAFLVHLFEPETSNDPN
WQPAYIKDENMILEVSTGRKFFNMDLDIVEERLWNGYYSEPKQFLKDIELIYRDANTIGD
RERVIKASEMFANAQMGIEEISTPDFIQECKATRQRDLERQELFLEDEEKRAAMELEAKE
QSQENILQEPDLKDNKANEFGVAAGNQLQAQLQTTINTASIVNNSEVPQPIDTNLYKKEI
PAAIPSAVDKEKAVIPEDSGANEEYTTELIQATCTSEITTDDDERARKEPKENEDSLQTQ
VTEENFSKIDANTNNINHVKEIQSVNKPNSLHETVEKRERSPIPKEVVEPEQGKKSDKEL
ILTPEQIKKVSACLIEHCQNFTVSQLEDVHSSVAKIIWKSKSAWDKTGTVDEIIKFLSE
NT seq 4140 nt NT seq  +upstreamnt  +downstreamnt
atggcacgaaatttaaggaatagacgcggtagcgacgttgaagatgcaagcaacgcaaag
gttgggtatgaaacacagattaaagacgaaaatggcataatccatacaacaactcgctct
ttgagaaaaataaactacgcagaaattgagaaagtgtttgattttttggaagatgaccag
gtcatggacaaagatgagacgcccgttgatgttactagtgatgaacatcataacaacaac
cagaaaggcgatgatgaagacgatgatgttgatcttgtatcaccgcacgaaaacgccaga
acgaacgaagagcttactaatgaaaggaacttgagaaaaagaaaagcgcatgatccagaa
gaagatgacgaaagttttcatgaggaagatgtcgacgatgatgaagaggaggaagaagca
gacgaatttgaagatgagtatttggatgaagactcgaaggataacaaccgtcggcgcaga
gcggccgataggaaatttgtagtaccagaccctgatgacgatgaagaatacgatgaggat
gacgaagaaggagacagaataagccattcggcttcttctaaacgtttgaaaagggcaaat
tctcgaagaacaagatcgtcacgtcacccagaaactccaccaccggtaagaagagcttta
agaagtaggacaagacattcgcgtacttcaaatgaagaaaatgacgatgagaatgataat
agcaggaatgaagcgttaactttagctgatgaaattagagagttacaggaagatagtcct
atcagggaaaaaagatttcttcgcgaaagaactaagccggtaaattacaaattaccacca
ccactaactgctagcaacgcagaagaatttatagataagaataacaatgcactttctttt
cataacccatcacctgcacggcgtggtcgcggtggttggaatgctagtcaaaattctggt
cccacaagaaggctttttcccactggtggaccttttggtggcaatgacgtaactacaata
tttggtaagaatactaatttttacaaccaagtcccatctgcattcagtgataataacaac
aataaattaatactggattcagactcttccgatgatgagatattacctcttggcgtgaca
ccgaaaacaaagaaagagaacacgcaaaaaaagaagaagaaaaaaccagaaattgcagac
ctcgatccattaggcgtagacatgaatgtaaattttgacgatataggtggtttagacaac
tacattgaccaattaaaggaaatggtggccttaccactattatacccagaattgtatcaa
aattttaatatcacgcccccaaggggtgttcttttccatggtcctcctggtacgggtaaa
acacttatggcaagagcgttagcagcaagttgttcttctgatgaaaggaagatcacattt
tttatgcgtaaaggtgcagatattttatccaagtgggttggtgaagctgaaagacaactc
cgtttgttattcgaagaagctaaaaaacatcaaccttccatcattttttttgatgaaatc
gacggattagcgcctgtgagaagttccaaacaagaacagatccatgctagtattgtttcc
acattattagcgctgatggatggtatggacaatagaggccaagtcattgtcatcggagcc
acaaatcgacccgatgcagtggatcccgcattaagaaggccgggaagatttgatagagaa
ttttattttccattacctgatgttaaagcacgttttaaaattttgcaaattcagaccagg
aaatggagttcaccgttgtcaaccaacttcattgataaattggcttttttgaccaaagga
tatggtggtgctgatctgaggtccctatgcactgaggctgcactaataagtatacaaaga
agctttcctcaaatttataggtcaaatgataaactcttggtggacccttctaagattaaa
gtcaaagttagcgatttcatgttagctttgaaaaaaattgttccgtcatctgcgagatct
actggtagttctcctcagccactacctgaattaatcaaaccattactggcagatcaactt
aataatttaaagaacaagctggattatatgctgaacattaaagacacaacttttcagaga
aacacatcattgctacaaaatttcatcgattatgaagaatacagtggagaggaagaagag
catgacaaatatggaggaaatgaagatacatccagttttagatcatatgagtttttcgaa
tcgatggcggaatcacaaatttgtaaacctcggttattaataaatgggcccaagggaaat
ggtcaacaatatgtcggagccgcaattttaaattatttagaagaattcaacgtccaaaac
ctggaccttgcctctttggtttcggaaagttctaggactattgaagctgctgtagtgcaa
agttttatggaagcaaagaaaagacagccctcagttgtatttattcctaatttagacatt
tggatcaacactattccagaaaacgttattttagtcttatcaggtttgttcagatcttta
caaagcaatgaaaaaattcttctattatgcttagctgaaaatcttgatatatctgaagtt
aaaaatggtattttatctgattttgcttttgataaaaatatctttcaactgcataaacca
tccaaagagaatataacgaggtatttttctaatttaattgaactactgaaaacaaagcca
agtgatattcccatgaaaaagagaagagtcaaaccgttacctgaattacaaaaagtaact
tcaaacgcagctccaacaaattttgatgaaaatggtgagccactgtctgaaaaagtggta
ttaagaaggaagttgaaatcttttcaacaccaagatatgagattgaaaaatgtgttaaaa
atcaaactctcaggcttgatggatctttttaaaaacagatataaaaggtttagaaaacca
cctattgatgatgccttcttggttcatcttttcgaaccagagacaagcaatgatcccaat
tggcaacctgcatatataaaagatgagaacatgattctggaggtttcaacagggcgaaag
ttttttaacatggatttggatattgtcgaagagagactttggaatggctattactcagaa
ccaaaacagtttttaaaagacattgaactgatatacagggatgcaaataccattggggac
agagaacgtgtcattaaggcctctgagatgtttgccaacgcgcaaatgggtatcgaagaa
atttcaaccccggattttattcaagagtgtaaagctactcgccaaagggatttggaaagg
caggaacttttcttagaagatgaagagaaaagagctgcaatggaattagaagccaaagaa
cagagtcaagaaaatatactgcaagaacctgatttaaaggataacaaggctaatgagttt
ggtgtagctgctggtaatcaattgcaagctcagctgcaaacaactatcaatacagcctct
atcgttaataacagcgaggtccctcaaccaattgataccaacctgtataaaaaggagatt
cctgcggcaattccctctgcagtagataaagaaaaagcggtcatccctgaggatagcggt
gcaaatgaagaatacacaacggaactgatacaggccacttgcacgtcagagataaccacc
gatgatgatgaaagggccagaaaagaaccaaaagagaatgaagactctttgcaaacgcag
gttacggaagaaaacttcagcaaaatagacgctaatactaataatataaatcacgtaaag
gaaattcaatcggttaacaaaccaaattccctccacgaaacggtagaaaaaagggaacga
agtccgataccaaaagaggttgtggaaccggagcaagggaagaagagcgacaaggagctt
attttgacgcccgaacaaataaaaaaagtatctgcatgcttaatcgaacactgtcagaat
tttacggtttctcaattagaagatgttcattcgtccgttgcaaaaataatatggaaaagt
aaatcagcatgggataaaacaggaactgtcgatgaaataataaaatttttatctgaataa

DBGET integrated database retrieval system