KEGG   Saccharomyces cerevisiae (budding yeast): YGR274CHelp
Entry
YGR274C           CDS       T00005                                 

Gene name
TAF1, KAT4, TAF130, TAF145
Definition
(RefSeq) Taf1p
  KO
K03125  transcription initiation factor TFIID subunit 1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03022  Basal transcription factors
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    YGR274C (TAF1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sce01001]
    YGR274C (TAF1)
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:sce03021]
    YGR274C (TAF1)
   03036 Chromosome and associated proteins [BR:sce03036]
    YGR274C (TAF1)
Protein kinases [BR:sce01001]
 Serine/threonine kinases: Other
  TAF1 family
   YGR274C (TAF1)
Transcription machinery [BR:sce03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIID
     YGR274C (TAF1)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    YGR274C (TAF1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3591 zf-CCHC_6 zf-CCHC
Motif
Other DBs
NCBI-GeneID: 853191
NCBI-ProteinID: NP_011790
SGD: S000003506
UniProt: P46677
Structure
PDB: 

Position
VII:complement(1039895..1043095)
Genome map
AA seq 1066 aa AA seqDB search
MVKQQGSGKTNLANEDEAYEAIFGGEFGSLEIGSYIGGDEGANSKDYTEHLPDAVDFEDE
DELADDDDDLPEESDANLHPAMMTMGAYDDVNENGAVLGIDSNSLNMQLPEINGDLSQQF
ILEDDGGTPATSNALFMGMDANEIHLATETGVLDGSGANEIGHSQLSIGGVNGNDMSING
GFIMEPDMSDGKHKKATKLDLINHEKYLLKKYFPDFEKGKILKWNKLIYRRSVPYHWHSE
ISRVKKPFMPLNLKFKVQQDDKRLFNSRTISYVAPIYQGKNNLLQSNSSASRRGLIHVSI
DELFPIKEQQKKRKIIHDEKTISEDLLIATDDWDQEKIINQGTSSTATLADSSMTPNLKF
SGGYKLKSLIEDVAEDWQWDEDMIIDAKLKESKHAELNMNDEKLLLMIEKTNNLAQQKQQ
LDSSNLILPLNETILQQKFNLSNDDKYQILKKTHQTKVRSTISNLNIQHSQPAINLQSPF
YKVAVPRYQLRHFHRENFGSHIRPGTKIVFSKLKARKRKRDKGKDVKESFSTSQDLTIGD
TAPVYLMEYSEQTPVALSKFGMANKLINYYRKANEQDTLRPKLPVGETHVLGVQDKSPFW
NFGFVEPGHIVPTLYNNMIRAPVFKHDISGTDFLLTKSSGFGISNRFYLRNINHLFTVGQ
TFPVEEIPGPNSRKVTSMKATRLKMIIYRILNHNHSKAISIDPIAKHFPDQDYGQNRQKV
KEFMKYQRDGPEKGLWRLKDDEKLLDNEAVKSLITPEQISQVESMSQGLQFQEDNEAYNF
DSKLKSLEENLLPWNITKNFINSTQMRAMIQIHGVGDPTGCGEGFSFLKTSMKGGFVKSG
SPSSNNNSSNKKGTNTHSYNVAQQQKAYDEEIAKTWYTHTKSLSISNPFEEMTNPDEINQ
TNKHVKTDRDDKKILKIVRKKRDENGIIQRQTIFIRDPRVIQGYIKIKEQDKEDVNKLLE
EDTSKINNLEELEKQKKLLQLELANLEKSQQRRAARQNSKRNGGATRTENSVDNGSDLAG
VTDGKAARNKGKNTTRRCATCGQIGHIRTNKSCPMYSSKDNPASPK
NT seq 3201 nt NT seq  +upstreamnt  +downstreamnt
atggtaaagcagcagggatccggcaagaccaacttggccaacgaagatgaagcatatgaa
gctatttttggcggagagtttggctctttagaaatcgggtcatacattggcggggatgaa
ggtgccaattcaaaggactatacggagcatttgccggatgctgtagattttgaagatgaa
gatgaacttgctgatgacgatgacgatttgccagaagaatctgatgctaatttgcatcca
gctatgatgactatgggcgcgtatgatgatgtaaacgagaacggtgccgtactcggtatc
gactcaaatagtttgaatatgcaactgcctgaaattaatggtgatttgtctcaacagttt
attttggaggatgatgggggtactcccgcaactagcaatgctttgtttatgggaatggat
gcaaatgaaattcatctcgccactgaaactggagttcttgatggtagtggcgcaaatgaa
attgggcattctcaactttccattggtggcgttaatggaaatgatatgtcgataaatggt
ggatttatcatggaaccagatatgtcagatggcaagcataagaaagccaccaaattagac
ttgataaaccatgagaagtatcttctaaaaaaatactttcctgattttgaaaagggtaaa
attttaaaatggaacaagctgatttatagaagatctgttccttatcattggcacagtgaa
atatctagggtaaagaaaccgtttatgcctttaaatttgaaattcaaggttcaacaggat
gataagaggctattcaactcaaggacaatatcttacgtcgctccgatttatcaagggaaa
aacaatttacttcaaagtaactcttctgcatcccgaagaggtttaattcatgtttccatt
gatgaacttttccctatcaaagagcaacaaaaaaaaagaaagattattcatgatgaaaag
accatatcggaagacttgcttattgccactgatgattgggaccaagaaaaaatcatcaac
caaggtacttcatcaacagcaaccttggcggattcgtctatgacacccaacttaaagttc
tccggcggttataaattgaagagcttgattgaggatgttgctgaagattggcagtgggat
gaagacatgatcattgatgcaaaattgaaagagtctaaacatgctgaattaaatatgaat
gacgaaaaactgttgctgatgattgagaaaacaaataatttagcgcagcaaaagcaacaa
ctggatagtagtaacttgatattgcccctcaacgaaactattttgcaacaaaaattcaat
ttatctaatgatgataaatatcaaatcttgaaaaaaacccatcaaacaaaagttcgttct
accatctcgaacttaaatattcagcattctcaacctgcgattaatttacaatctccattt
tacaaagtggctgttcctagataccagttgaggcatttccaccgtgaaaactttggttcg
cacatcagaccaggtactaaaattgtcttcagtaagttaaaagcgcgtaaaaggaaaaga
gataaaggtaaagatgtcaaagaatcattttctacatctcaagatctaaccatcggggat
actgctcctgtttatttaatggaatattctgaacaaacaccggtagctttgtctaaattt
ggtatggccaataaattaattaattattatcggaaagccaatgaacaagatactctaagg
cccaaattgcctgttggcgaaactcacgttttgggagttcaagacaaatcaccattttgg
aactttggatttgttgaacctggtcatatcgtccccacattatacaataacatgattaga
gcacccgttttcaaacatgatatatcaggaacagattttcttctgacaaaaagttccgga
tttggtataagcaatcgattttacttacgtaatattaaccatctttttacggttggacaa
acttttcctgtcgaggagattcccggacctaattcaagaaaggtgacatcaatgaaagct
acaagactgaaaatgattatttatagaattctaaaccataatcacagcaaggcaatttct
attgatcccattgcaaagcactttcccgaccaagattatggacaaaacagacaaaaagtg
aaggagttcatgaaatatcaaagagatggtcctgaaaaaggtctgtggaggcttaaagat
gatgaaaaattgttagacaatgaagcagtgaaaagtttaattacgccagagcagatcagc
caagttgaatcaatgagtcagggcttacaattccaagaagataatgaagcatataatttt
gattctaagctaaaatctctagaagaaaacttgttaccatggaacattacaaaaaatttt
attaattcaacacaaatgcgagctatgatacaaatacatggtgttggtgacccaacgggc
tgtggtgaaggtttttctttcttgaaaacttcaatgaaaggtggttttgttaagtctggt
tctccttccagtaataacaatagttcaaacaaaaaaggcactaacacgcatagctacaat
gtggctcaacagcaaaaagcttacgacgaagaaattgcgaagacctggtatacacataca
aaatcgttgagcataagcaatccttttgaggaaatgaccaatcctgatgagattaatcag
accaacaagcatgttaagacggatagagatgataagaaaattctgaagattgttagaaag
aaaagagatgaaaatggtataattcaaaggcagacaattttcataagagatcctagggtc
attcaaggatatataaaaatcaaagaacaggataaagaagatgttaacaaattgttagag
gaggacacttcaaagataaataacttggaagaacttgagaaacagaaaaaactgttgcaa
ctagaattagctaatttggaaaaatcacagcaacgtagagcagcaaggcaaaattcgaag
agaaatggtggtgccacgagaacagaaaactctgtggataatggtagcgaccttgccggt
gtaactgacgggaaagcagccaggaataaaggtaagaacactacaaggagatgtgctaca
tgcggacaaatcgggcacattagaacaaataaatcttgtccaatgtatagcagtaaagat
aaccctgcttcaccaaagtag

DBGET integrated database retrieval system