KEGG   Saccharomyces cerevisiae (budding yeast): YGR275WHelp
Entry
YGR275W           CDS       T00005                                 

Gene name
RTT102
Definition
(RefSeq) Rtt102p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rtt102p STAT_alpha
Motif
Other DBs
NCBI-GeneID: 853192
NCBI-ProteinID: NP_011791
SGD: S000003507
UniProt: P53330
Structure
PDB: 

Position
VII:1043276..1043749
Genome map
AA seq 157 aa AA seqDB search
MDPQTLITKANKVSYYGNPTSKESWRYDWYQPSKVSSNVQQPQQQLGDMENNLEKYPFRY
KTWLRNQEDEKNLQRESCEDILDLKEFDRRILKKSLMTSHTKGDTSKATGAPSANQGDEA
LSVDDIRGAVGNSEAIPGLSAGVNNDNTKESKDVKMN
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atggacccacagacgctcattactaaggccaataaggtttcttactatggcaaccctacg
agtaaggaatcatggaggtatgattggtaccaaccatctaaggtgagctccaatgtgcag
caaccacaacaacagctaggggacatggagaataacttggagaaatatccattcaggtat
aaaacatggttgaggaaccaggaagatgagaaaaatctacagagggagagctgtgaggat
atattagatttgaaagaatttgatagaagaatactgaaaaagtcgttgatgacatcgcac
actaagggtgatacaagtaaggccaccggtgctccttctgctaatcaaggagatgaagct
cttagtgtggatgatataagaggcgctgtcggtaatagtgaagccattcctgggttatct
gcgggagtgaacaatgataatacaaaggagagtaaagatgtgaaaatgaattaa

DBGET integrated database retrieval system