KEGG   Saccharomyces cerevisiae (budding yeast): YGR276CHelp
Entry
YGR276C           CDS       T00005                                 

Gene name
RNH70, REX1, RNA82
Definition
(RefSeq) Rnh70p
  KO
K14570  RNA exonuclease 1 [EC:3.1.-.-]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    YGR276C (RNH70)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:sce03009]
    YGR276C (RNH70)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     YGR276C (RNH70)
Ribosome biogenesis [BR:sce03009]
 Eukaryotic Type
  Pre-60S particles
   RNases
    YGR276C (RNH70)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNase_T
Motif
Other DBs
NCBI-GeneID: 853193
NCBI-ProteinID: NP_011792
SGD: S000003508
UniProt: P53331
Position
VII:complement(1043819..1045480)
Genome map
AA seq 553 aa AA seqDB search
MQVEGPDTNFVSDLALGSKKRRLSKTSVQEDDHTNVVSEVNKNKKKKKAKPMTCTLLKSV
VEKGIGIKDVRDMTQYLLQAENNSPKWIDICNRSSLQKMIVLFIPGLQPDDFENGKNTFN
EISDDNFKYIPGEIASTFHTFPVMAPGSKMTLFSPYNSFINVGLSKMEKINKLKELQKKK
KITINDLVLSEQQLVANDYPLDSGDTNFDTDWVQTVDFTHGGSHIFALDCEMCLSEQGLV
LTRISLVNFDNEVIYEELVKPDVPIVDYLTRYSGITEEKLTVGAKKTLREVQKDLLKIIS
RSDILIGHSLQNDLKVMKLKHPLVVDTAIIYHHKAGDPFKPSLKYLSETFLNKSIQNGEH
DSVEDARACLELTKLKILNGLAFGIGINTENLFTKLHRFEVKTVLLNDMIIKNHTEDDSK
GQLIRCVEDDETWTHIHENLNKDVKLIVGRIKNLERSRNYNKKPRKETPSFDASMVLHDI
GQHLTQLYENATPGTMILIMSGTGDTRPWNNLSTELEFIQDKKERLDKRREREPEIVEAI
KLARGGVASFTVK
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgcaagtagaagggcctgacactaacttcgtgagtgatttggctttgggatcaaagaaa
agaaggttatccaagacttctgtacaagaggatgatcatacaaatgtggtatcggaagtg
aataagaataagaagaaaaaaaaggcaaagcctatgacatgcacattgctaaagtctgtg
gttgaaaaaggtattggtataaaggatgtaagagacatgactcaatacttgttgcaggct
gaaaacaactctcccaaatggattgatatttgtaacaggtcaagtttacagaaaatgata
gttctgttcattccaggtttacaaccagatgattttgagaacggaaaaaatacctttaat
gaaatcagtgatgataacttcaaatatattcctggagaaattgcctccacgtttcataca
tttcccgtgatggcacctggttccaagatgacgctcttttcgccctacaattcatttatt
aatgttggattgtccaaaatggagaaaataaataaattgaaagagttacaaaagaagaag
aaaattactattaacgatttggttctatccgaacaacagttagtggcaaacgattaccca
ctggattctggagacaccaattttgatacagactgggtacaaactgttgactttacccat
ggtggctcccacatctttgcactagactgtgaaatgtgtctttccgaacaaggtttagtt
ctaactaggatttctctagtgaattttgacaatgaagttatctatgaagagttggtgaaa
cctgatgtccccatagtggactatttgacacgttacagtggtataactgaagagaaacta
actgttggtgccaagaaaacattgcgagaagtacaaaaagatttactaaagataataagt
cgttcagatattttgataggacattcgctacagaatgatttgaaagtcatgaaattgaaa
catccattggtcgtggatacagctattatataccatcataaagctggcgatcctttcaag
ccaagtttaaaatacttgagcgaaacctttctgaataaaagcattcaaaacggagaacac
gattctgtcgaagatgcaagggcttgtcttgaattgacgaaattaaaaatcttaaatggg
ttagcatttgggataggtatcaatacggagaacttgttcaccaaattacatcgttttgaa
gtgaaaaccgttcttctcaacgatatgattattaaaaatcatactgaggacgattctaag
ggccagttaatccgttgcgtcgaagatgatgagacatggacccatattcacgagaatcta
aataaagatgtcaaacttattgtggggagaatcaagaacttagagaggtcacgcaactat
aataaaaagccacggaaggaaactccttcgttcgatgcgtccatggttcttcatgatata
gggcaacatctaacacaattatacgagaatgctacaccaggtactatgattttgatcatg
tcgggtacaggcgacacaagaccatggaacaatctttcaactgagttagagtttattcaa
gacaaaaaggaaagattagataaaagacgcgaaagggaacctgaaatagtagaagccata
aagttagcccggggtggtgtagcatcctttactgtaaaataa

DBGET integrated database retrieval system