KEGG   Saccharomyces cerevisiae (budding yeast): YGR277CHelp
Entry
YGR277C           CDS       T00005                                 

Gene name
CAB4
Definition
(RefSeq) putative pantetheine-phosphate adenylyltransferase
  KO
K02201  pantetheine-phosphate adenylyltransferase [EC:2.7.7.3]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00770  Pantothenate and CoA biosynthesis
sce01100  Metabolic pathways
Module
sce_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    YGR277C (CAB4)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.3  pantetheine-phosphate adenylyltransferase
     YGR277C (CAB4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CTP_transf_like
Motif
Other DBs
NCBI-GeneID: 853194
NCBI-ProteinID: NP_011793
SGD: S000003509
UniProt: P53332
Position
VII:complement(1045644..1046561)
Genome map
AA seq 305 aa AA seqDB search
MVEENSRVLIVLPYTPPSATLQRIIGQTIPFLRECQSQLDIVIVPEFKTSFQLDSALGKM
YSITRDVLLGYGMINSGINIIFNNIHFVESNLQWKVVLLPQESTFETWKLELGQGQYHSI
EHYALHDNIMEEIEGPKDANKFHVTALGGTFDHIHDGHKILLSVSTFITSQRLICGITCD
ELLQNKKYKELIEPYDTRCRHVHQFIKLLKPDLSVELVPLRDVCGPTGKVPEIECLVVSR
ETVSGAETVNKTRIEKGMSPLAVHVVNVLGGREEDGWSEKLSSTEIRRLLKSSASPTCTP
QNPCV
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atggttgaggaaaattccagagttttgattgttcttccttatacaccgcctagtgctact
ttgcagaggattatagggcaaactattccgttcttaagagaatgtcaaagtcaactagac
atcgtgattgtacctgaattcaaaacctcattccagttggattctgcgctagggaagatg
tacagtattaccagggatgtccttttgggctatggaatgatcaacagcggaatcaacatc
atattcaacaatattcatttcgtcgagagtaatttgcaatggaaagtggttttattgcca
caggaatccacttttgaaacttggaagctagagttgggacaaggacaataccatagtata
gaacattatgcattacacgataatataatggaagagatagaaggtcccaaagatgctaac
aaatttcatgtcaccgcattgggcggaacgttcgaccacattcacgatggacataaaata
ttgttgagcgtctctacattcatcacgtcacaaaggttaatttgtggaattacgtgcgat
gagctcttgcaaaacaagaaatacaaagagttgattgaaccttatgatacacgatgcagg
cacgtacatcaattcatcaagttgttaaaaccggatctctccgtagaactagttccctta
agggacgtgtgcggccccacagggaaagtacccgagatagaatgtttagttgtgagtaga
gaaaccgtcagtggggcagagactgtgaataagactaggattgaaaaaggcatgagccca
ttggcagtacatgtggttaatgtacttggaggaagggaggaagacggctggagcgagaag
ttaagcagcacggaaatcagacgcctacttaagtcctctgcttcgccaacgtgcactcca
caaaacccttgcgtataa

DBGET integrated database retrieval system