KEGG   Saccharomyces cerevisiae (budding yeast): YGR279CHelp
Entry
YGR279C           CDS       T00005                                 

Gene name
SCW4
Definition
(RefSeq) putative family 17 glucosidase
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_17
Motif
Other DBs
NCBI-GeneID: 853196
NCBI-ProteinID: NP_011795
SGD: S000003511
UniProt: P53334
Position
VII:complement(1048798..1049958)
Genome map
AA seq 386 aa AA seqDB search
MRLSNLIASASLLSAATLAAPANHEHKDKRAVVTTTVQKQTTIIVNGAASTPVAALEENA
VVNSAPAAATSTTSSAASVATAAASSSENNSQVSAAASPASSSAATSTQSSSSSQASSSS
SSGEDVSSFASGVRGITYTPYESSGACKSASEVASDLAQLTDFPVIRLYGTDCNQVENVF
KAKASNQKVFLGIYYVDQIQDGVNTIKSAVESYGSWDDVTTVSIGNELVNGNQATPSQVG
QYIDSGRSALKAAGYTGPVVSVDTFIAVINNPELCDYSDYMAVNAHAYFDKNTVAQDSGK
WLLEQIQRVWTACDGKKNVVITESGWPSKGETYGVAVPSKENQKDAVSAITSSCGADTFL
FTAFNDYWKADGAYGVEKYWGILSNE
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgcgtctctctaacctaattgcttctgcctctcttttatctgctgctactcttgctgct
cccgctaaccacgaacacaaggacaagcgtgctgtggtcactaccactgttcaaaaacaa
accactatcattgttaatggtgccgcttcaactccagttgctgctttggaagaaaatgct
gttgtcaactccgctccagctgccgctaccagtacaacatcgtctgctgcttctgtagct
accgctgctgcttcctcttctgagaacaactcacaagtttctgctgccgcatctccagcc
tccagctctgctgctacatctactcaatcttcctcttcctcccaagcttcttcctctagt
tcttccggcgaagacgtcagcagctttgcctctggtgtcagaggtatcacttatacccca
tacgagtccagcggtgcttgtaaatccgcttcggaagttgcttccgatttagctcaattg
actgacttcccagtcattagattgtacggtaccgactgtaaccaagttgaaaatgttttc
aaggctaaggcttcgaaccaaaaagtctttttaggtatttactacgttgaccaaatccaa
gacggtgtcaacaccatcaagtctgctgttgaatcttacggttcttgggacgatgtcacc
actgtttccattggtaacgaattggttaacggtaaccaagctaccccatcccaagtcggt
caatacattgactctggtagatctgccttgaaggctgccggttacactggtccagttgtt
tctgttgatacttttattgctgtgatcaacaaccctgaattgtgtgactactccgactac
atggctgttaatgcccatgcttactttgacaagaacacagttgcccaagactccggtaaa
tggttactagaacaaatccaaagagtctggactgcttgtgatggtaagaagaatgttgtt
atcactgagtctggttggccatcaaagggtgagacttacggtgttgctgttccatctaag
gaaaatcaaaaggacgctgtttccgccattaccagctcctgtggtgctgataccttctta
ttcactgccttcaacgactactggaaggccgacggtgcttacggtgttgaaaaatactgg
ggtattctatccaatgaataa

DBGET integrated database retrieval system