KEGG   Saccharomyces cerevisiae (budding yeast): YGR286CHelp
Entry
YGR286C           CDS       T00005                                 

Gene name
BIO2
Definition
(RefSeq) biotin synthase
  KO
K01012  biotin synthase [EC:2.8.1.6]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00780  Biotin metabolism
sce01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    YGR286C (BIO2)
Enzymes [BR:sce01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.6  biotin synthase
     YGR286C (BIO2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BATS Radical_SAM INPP5B_PH
Motif
Other DBs
NCBI-GeneID: 853203
NCBI-ProteinID: NP_011802
SGD: S000003518
UniProt: P32451
Position
VII:complement(1063813..1064940)
Genome map
AA seq 375 aa AA seqDB search
MMSTIYRHLSTARPALTKYATNAAVKSTTASSEASTLGALQYALSLDEPSHSWTKSQLKE
IYHTPLLELTHAAQLQHRKWHDPTKVQLCTLMNIKSGGCSEDCKYCAQSSRNDTGLKAEK
MVKVDEVIKEAEEAKRNGSTRFCLGAAWRDMKGRKSAMKRIQEMVTKVNDMGLETCVTLG
MVDQDQAKQLKDAGLTAYNHNIDTSREHYSKVITTRTYDDRLQTIKNVQESGIKACTGGI
LGLGESEDDHIGFIYTLSNMSPHPESLPINRLVAIKGTPMAEELADPKSKKLQFDEILRT
IATARIVMPKAIIRLAAGRYTMKETEQFVCFMAGCNSIFTGKKMLTTMCNGWDEDKAMLA
KWGLQPMEAFKYDRS
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgatgtctactatctaccgtcatttatctaccgctagaccggctttaactaaatacgca
accaatgccgcagttaaatcgacaactgcatcctcagaagctagtactctgggtgctcta
caatatgcattgtctttagatgaaccaagtcattcgtggacaaaatcgcaattaaaagaa
atttatcataccccactgctcgaacttactcatgcagcacaattgcagcacagaaagtgg
cacgatccaaccaaagtgcaattgtgcacattgatgaacatcaaatctggtggttgttct
gaggactgtaagtattgtgcgcagtcttcgagaaacgataccggtctaaaggctgagaaa
atggttaaagtggatgaagtgattaaagaggcagaagaggccaaaagaaacggatctact
agattctgcctaggtgctgcatggagagacatgaaaggtcgtaaatcagccatgaaaaga
attcaggaaatggtgaccaaagtgaatgatatggggctagaaacgtgtgttactttaggt
atggttgatcaagatcaagcaaagcaattgaaagatgcaggtttgactgcatacaaccat
aacatcgacacttccagagaacactatagtaaggtcatcaccacgagaacctacgacgac
aggttacagaccatcaagaatgtccaagaatctggaataaaagcctgtaccggtggtatt
ttgggtctcggtgaaagcgaagacgaccatataggattcatctacacattatccaatatg
tctcctcatcctgagtccctaccaattaatagactagttgctatcaaagggactccaatg
gctgaggaacttgccgatccaaagagtaaaaagttgcaattcgacgaaattttgagaacc
attgccacagcgagaatagttatgccaaaggccattataagacttgccgctggtcgttat
acaatgaaagaaacagagcaatttgtctgtttcatggcaggttgtaacagtatcttcacc
ggtaagaaaatgctgacgacaatgtgtaacggttgggacgaagacaaggcaatgttggct
aaatggggattgcaacctatggaggcatttaagtacgacagatcttga

DBGET integrated database retrieval system