KEGG   Saccharomyces cerevisiae (budding yeast): YGR287C
Entry
YGR287C           CDS       T00005                                 

Gene name
IMA1
Definition
(RefSeq) oligo-1,6-glucosidase IMA1
  KO
K01182  oligo-1,6-glucosidase [EC:3.2.1.10]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00052  Galactose metabolism
sce00500  Starch and sucrose metabolism
sce01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    YGR287C (IMA1)
   00500 Starch and sucrose metabolism
    YGR287C (IMA1)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.10  oligo-1,6-glucosidase
     YGR287C (IMA1)
SSDB
Motif
Pfam: Alpha-amylase Malt_amylase_C hDGE_amylase
Other DBs
NCBI-GeneID: 853204
NCBI-ProteinID: NP_011803
SGD: S000003519
UniProt: P53051
Structure
PDB: 
3AJ7 3AXI 3A47 3A4A 3AXH

Position
VII:complement(1067222..1068991)
AA seq 589 aa
MTISSAHPETEPKWWKEATFYQIYPASFKDSNDDGWGDMKGIASKLEYIKELGADAIWIS
PFYDSPQDDMGYDIANYEKVWPTYGTNEDCFALIEKTHKLGMKFITDLVINHCSSEHEWF
KESRSSKTNPKRDWFFWRPPKGYDAEGKPIPPNNWKSYFGGSAWTFDEKTQEFYLRLFCS
TQPDLNWENEDCRKAIYESAVGYWLDHGVDGFRIDVGSLYSKVVGLPDAPVVDKNSTWQS
SDPYTLNGPRIHEFHQEMNQFIRNRVKDGREIMTVGEMQHASDETKRLYTSASRHELSEL
FNFSHTDVGTSPLFRYNLVPFELKDWKIALAELFRYINGTDCWSTIYLENHDQPRSITRF
GDDSPKNRVISGKLLSVLLSALTGTLYVYQGQELGQINFKNWPVEKYEDVEIRNNYNAIK
EEHGENSEEMKKFLEAIALISRDHARTPMQWSREEPNAGFSGPSAKPWFYLNDSFREGIN
VEDEIKDPNSVLNFWKEALKFRKAHKDITVYGYDFEFIDLDNKKLFSFTKKYNNKTLFAA
LNFSSDATDFKIPNDDSSFKLEFGNYPKKEVDASSRTLKPWEGRIYISE
NT seq 1770 nt   +upstreamnt  +downstreamnt
atgactatttcttctgcacatccagagacagaaccaaagtggtggaaagaggccacgttc
tatcaaatttacccagcaagtttcaaagactctaatgacgatggctggggtgacatgaaa
gggattgcctccaagctggagtacatcaaagagcttggtgccgatgccatttggatctca
ccattctacgactcgccacaagatgatatgggttacgatattgccaactacgaaaaggtc
tggccaacatatggtacgaatgaagactgctttgccttgatcgaaaagacacataagctt
ggtatgaaatttatcaccgacttggtcatcaatcactgttccagcgaacatgaatggttc
aaagagagcagatcctcgaagactaatccaaagcgtgactggttcttctggagacctcct
aaaggttatgacgccgaaggcaagccaattcctccaaacaattggaaatcctattttggt
ggttccgcatggaccttcgatgaaaagacacaagaattctacttgcgtttgttttgctcc
actcaacctgatttgaattgggagaatgaagactgtagaaaggcaatctacgaaagtgcc
gttggatactggttagaccatggtgtagacggctttagaattgatgtcggaagtttgtac
tccaaagttgtaggtttaccagatgctcctgttgttgacaaaaactcgacttggcaatcc
agtgatccatacacattgaatggaccacgtattcacgagttccatcaagaaatgaatcaa
ttcatcagaaacagagtgaaggatggcagggagattatgacagttggtgaaatgcaacat
gcctccgacgaaactaagagactttatacgagtgcttcaagacacgaacttagtgagtta
tttaacttttcccacactgatgtggggacttcacctttgttccgttacaacttggtccca
tttgaactgaaggattggaagattgcccttgctgagctgttcaggtacattaatggtaca
gattgttggtcaacaatctatctggaaaatcacgaccaacctcgttcaattacgagattt
ggtgacgattctcccaagaaccgtgttatttctggtaagttactctctgtgttgctaagt
gccttgaccggtactctatatgtgtatcagggacaagagcttggccaaatcaatttcaag
aactggcctgttgaaaagtacgaggatgtcgaaatcagaaacaactacaatgccattaaa
gaagagcatggggaaaactcagaggagatgaaaaagtttttagaagccattgcccttatc
tccagggaccatgctagaacacctatgcaatggtctcgtgaggagccaaatgctggtttt
tctggtcctagtgctaaaccatggttttacttgaacgactctttcagagaaggcattaac
gtcgaagatgaaatcaaggatcccaactcggttttgaacttctggaaggaggccttgaag
tttagaaaggcgcataaagacattactgtgtacggatacgatttcgagtttattgattta
gacaataagaagttgtttagcttcacaaagaagtacaacaataaaacattgtttgcggct
ttgaactttagctctgatgcgacagatttcaagattccaaatgatgattcatcgttcaag
ttagagtttggaaactatccaaagaaggaggtagatgcctcttccagaacattgaagcca
tgggaaggaagaatatatatcagcgaatga

DBGET integrated database retrieval system