KEGG   Saccharomyces cerevisiae (budding yeast): YGR289C
Entry
YGR289C           CDS       T00005                                 
Symbol
MAL11, AGT1
Name
(RefSeq) alpha-glucoside permease
  KO
K08141  MFS transporter, SP family, general alpha glucoside:H+ symporter
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sce02000]
    YGR289C (MAL11)
Transporters [BR:sce02000]
 Major facilitator superfamily (MFS)
  Sugar transporters
   Sugar porter (SP) family [TC:2.A.1.1]
    YGR289C (MAL11)
SSDB
Motif
Pfam: Sugar_tr MFS_1 DUF5455
Other DBs
NCBI-GeneID: 853207
NCBI-ProteinID: NP_011805
SGD: S000003521
UniProt: P53048
Position
VII:complement(1073963..1075813)
AA seq 616 aa
MKNIISLVSKKKAASKNEDKNISESSRDIVNQQEVFNTEDFEEGKKDSAFELDHLEFTTN
SAQLGDSDEDNENVINEMNATDDANEANSEEKSMTLKQALLKYPKAALWSILVSTTLVME
GYDTALLSALYALPVFQRKFGTLNGEGSYEITSQWQIGLNMCVLCGEMIGLQITTYMVEF
MGNRYTMITALGLLTAYIFILYYCKSLAMIAVGQILSAIPWGCFQSLAVTYASEVCPLAL
RYYMTSYSNICWLFGQIFASGIMKNSQENLGNSDLGYKLPFALQWIWPAPLMIGIFFAPE
SPWWLVRKDRVAEARKSLSRILSGKGAEKDIQVDLTLKQIELTIEKERLLASKSGSFFNC
FKGVNGRRTRLACLTWVAQNSSGAVLLGYSTYFFERAGMATDKAFTFSLIQYCLGLAGTL
CSWVISGRVGRWTILTYGLAFQMVCLFIIGGMGFGSGSSASNGAGGLLLALSFFYNAGIG
AVVYCIVAEIPSAELRTKTIVLARICYNLMAVINAILTPYMLNVSDWNWGAKTGLYWGGF
TAVTLAWVIIDLPETTGRTFSEINELFNQGVPARKFASTVVDPFGKGKTQHDSLADESIS
QSSSIKQRELNAADKC
NT seq 1851 nt   +upstreamnt  +downstreamnt
atgaaaaatatcatttcattggtaagcaagaagaaggctgcctcaaaaaatgaggataaa
aacatttctgagtcttcaagagatattgtaaaccaacaggaggttttcaatactgaagat
tttgaagaagggaaaaaggatagtgcctttgagctagaccacttagagttcaccaccaat
tcagcccagttaggagattctgacgaagataacgagaatgtgattaatgagatgaacgct
actgatgatgcaaatgaagctaacagcgaggaaaaaagcatgactttgaagcaggcgttg
ctaaaatatccaaaagcagccctgtggtccatattagtgtctactaccctggttatggaa
ggttatgataccgcactactgagcgcactgtatgccctgccagtttttcagagaaaattc
ggtactttgaacggggagggttcttacgaaattacttcccaatggcagattggtttaaac
atgtgtgtcctttgtggtgagatgattggtttgcaaatcacgacttatatggttgaattt
atggggaatcgttatacgatgattacagcacttggtttgttaactgcttatatctttatc
ctctactactgtaaaagtttagctatgattgctgtgggacaaattctctcagctatacca
tggggttgtttccaaagtttggctgttacttatgcttcggaagtttgccctttagcatta
agatattacatgaccagttactccaacatttgttggttatttggtcaaatcttcgcctct
ggtattatgaaaaactcacaagagaatttagggaactccgacttgggctataaattgcca
tttgctttacaatggatttggcctgctcctttaatgatcggtatctttttcgctcctgag
tcgccctggtggttggtgagaaaggatagggtcgctgaggcaagaaaatctttaagcaga
attttgagtggtaaaggcgccgagaaggacattcaagttgatcttactttaaagcagatt
gaattgactattgaaaaagaaagacttttagcatctaaatcaggatcattctttaattgt
ttcaagggagttaatggaagaagaacgagacttgcatgtttaacttgggtagctcaaaat
agtagcggtgccgttttacttggttactcgacatatttttttgaaagagcaggtatggcc
accgacaaggcgtttactttttctctaattcagtactgtcttgggttagcgggtacactt
tgctcctgggtaatatctggccgtgttggtagatggacaatactgacctatggtcttgca
tttcaaatggtctgcttatttattattggtggaatgggttttggttctggaagcagcgct
agtaatggtgccggtggtttattgctggctttatcattcttttacaatgctggtatcggt
gcagttgtttactgtatcgttgctgaaattccatcagcggagttgagaactaagactata
gtgctggcccgtatttgctacaatctcatggccgttattaacgctatattaacgccctat
atgctaaacgtgagcgattggaactggggtgccaaaactggtctatactggggtggtttc
acagcagtcactttagcttgggtcatcatcgatctgcctgagacaactggtagaaccttc
agtgaaattaatgaacttttcaaccaaggggttcctgccagaaaatttgcatctactgtg
gttgatccattcggaaagggaaaaactcaacatgattcgctagctgatgagagtatcagt
cagtcctcaagcataaaacagcgagaattaaatgcagctgataaatgttaa

DBGET integrated database retrieval system