KEGG   Saccharomyces cerevisiae (budding yeast): YGR292WHelp
Entry
YGR292W           CDS       T00005                                 

Gene name
MAL12
Definition
(RefSeq) alpha-glucosidase MAL12
  KO
K01182  oligo-1,6-glucosidase [EC:3.2.1.10]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00052  Galactose metabolism
sce00500  Starch and sucrose metabolism
sce01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sce00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    YGR292W (MAL12)
   00500 Starch and sucrose metabolism
    YGR292W (MAL12)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.10  oligo-1,6-glucosidase
     YGR292W (MAL12)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C hDGE_amylase
Motif
Other DBs
NCBI-GeneID: 853209
NCBI-ProteinID: NP_011808
SGD: S000003524
UniProt: P53341
Position
VII:1076599..1078353
Genome map
AA seq 584 aa AA seqDB search
MTISDHPETEPKWWKEATIYQIYPASFKDSNNDGWGDLKGITSKLQYIKDLGVDAIWVCP
FYDSPQQDMGYDISNYEKVWPTYGTNEDCFELIDKTHKLGMKFITDLVINHCSTEHEWFK
ESRSSKTNPKRDWFFWRPPKGYDAEGKPIPPNNWKSFFGGSAWTFDETTNEFYLRLFASR
QVDLNWENEDCRRAIFESAVGFWLDHGVDGFRIDTAGLYSKRPGLPDSPIFDKTSKLQHP
NWGSHNGPRIHEYHQELHRFMKNRVKDGREIMTVGEVAHGSDNALYTSAARYEVSEVFSF
THVEVGTSPFFRYNIVPFTLKQWKEAIASNFLFINGTDSWATTYIENHDQARSITRFADD
SPKYRKISGKLLTLLECSLTGTLYVYQGQEIGQINFKEWPIEKYEDVDVKNNYEIIKKSF
GKNSKEMKDFFKGIALLSRDHSRTPMPWTKDKPNAGFTGPDVKPWFLLNESFEQGINVEQ
ESRDDDSVLNFWKRALQARKKYKELMIYGYDFQFIDLDSDQIFSFTKEYEDKTLFAALNF
SGEEIEFSLPREGASLSFILGNYDDTDVSSRVLKPWEGRIYLVK
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgactatttctgatcatccagaaacagaaccaaagtggtggaaagaggccacaatctat
caaatttacccagcaagttttaaagactccaataacgatggctggggtgatttaaaaggt
atcacttccaagttgcagtatattaaagatcttggcgttgatgctatttgggtttgtccg
ttttatgactctcctcaacaagatatggggtatgatatatccaactacgaaaaggtctgg
cccacatatggtaccaatgaggactgttttgagctaattgacaagactcataagctgggt
atgaaattcatcaccgatttggttatcaaccactgttctacagaacacgaatggttcaaa
gagagcagatcctcgaagaccaatccgaagcgtgactggttcttctggagacctcctaag
ggttatgacgccgaaggcaagccaattcctccaaacaattggaaatctttctttggtggt
tcagcttggacttttgatgaaactacaaatgaattttacctccgtttgtttgcgagtcgt
caagttgacttgaattgggagaatgaagactgcagaagggcaatctttgaaagtgctgtt
ggattttggctggaccatggtgtagatggttttagaatcgataccgctggtttgtattcg
aaacgtcctggtttaccagattccccaatttttgacaaaacctcgaaattacaacatcca
aattgggggtctcacaatggtcctaggattcatgaatatcatcaagaactacacagattt
atgaaaaacagggtgaaagatggtagagaaataatgacagtcggtgaagttgcccatgga
agtgataatgctttatacaccagtgcagctagatacgaagtcagcgaagttttctccttc
acgcacgttgaagttggtacctcgccatttttccgttataacatagtgcccttcaccttg
aaacaatggaaagaagccattgcatcgaactttttgttcattaacggtactgatagttgg
gctaccacctacatcgagaatcacgatcaagcccggtcaattacgagatttgctgacgat
tcgccaaagtaccgtaaaatatctggtaagctgttaacattgctagaatgttcattgaca
ggtacgttgtatgtctatcaaggtcaggagataggccagatcaatttcaaggaatggcct
attgaaaagtatgaggacgttgatgtgaaaaacaactacgagattatcaaaaaaagtttt
ggtaaaaactcgaaggaaatgaaggatttttttaaaggaatcgccctactttctagagat
cattcgagaactcccatgccatggacgaaagataagcccaatgctggatttactggccca
gatgttaaaccttggtttctcttgaatgaatctttcgagcaaggaatcaatgttgagcag
gaatccagagatgatgactcagttctcaatttttggaaaagggccttgcaagccagaaag
aaatataaggaacttatgatttatggttacgatttccaattcattgatttagacagtgac
cagatctttagcttcactaaagagtacgaagacaagacgctgtttgctgctttaaatttc
agtggcgaagaaattgaattcagcctcccaagagaaggtgcttctttatcttttattctt
ggaaattatgatgatactgacgtttcctccagagttttgaaaccatgggaaggtagaatc
tacctcgtcaaataa

DBGET integrated database retrieval system