KEGG   Saccharomyces cerevisiae (budding yeast): YHL036W
Entry
YHL036W           CDS       T00005                                 
Symbol
MUP3
Name
(RefSeq) Mup3p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB
Motif
Pfam: AA_permease_2 AA_permease
Other DBs
NCBI-GeneID: 856349
NCBI-ProteinID: NP_011827
SGD: S000001028
UniProt: P38734
Position
VIII:26241..27881
AA seq 546 aa
MEPLLFNSGKANPSQDVFIDVEVGDITTKYGSTNTGSFSSMDTVEAQAIKAETARFMEVP
QGRHLGVFSTVVLFVSRIMGSGIFAVPSVILLNTGGNKLIYFAIWVFSAAIAFAGLYLFL
EFGSWIPKSGGRKNFLERSFERPRLLISVVFSCYSVLTGYALTGSIVFGKYVLSAFGVTD
DSWSKYVSISFIIFAVLIHGVSVRHGVFIQNALGGLKLIMIVLMCFAGLYTLFFYKSTGQ
VAWDLPVTQVEKDSLLSVSSIATAFISSFFCFSGWDTVHTVTSEIKNPVKTLKVSGPLSL
IICFVCYTMMNVAYLKVLTYEEIVSAGPLVGSVLFTKLFGPRVGGKFIAFSIAISAASNI
LVVIYSISRVNQEIFKEGYLPFSIHMSKNWPFDAPLPSISLCGFITIAWILILPKEGESF
NYLVSMDGYGNQFFLLLVAIGLFIWRFKHKNEVPEIRASTFGVLAIITLSLYMLMAPFFA
DPSLNRVGFLPPYQIMSLLVIVACFFFWLVKFVLLPKFFHYKLLPKITYLHDGLIVTEWV
KKPCLC
NT seq 1641 nt   +upstreamnt  +downstreamnt
atggaaccgctgctttttaatagtgggaaagcaaatccctctcaagatgttttcatagat
gtggaagttggtgatattaccacaaaatatggttccacaaatactggatcattcagttcg
atggatactgtggaagcgcaggcgataaaggcagagacggcaagattcatggaagttcca
cagggaagacatttaggtgtgttctccacggttgtgttatttgtttcgaggataatgggg
tcaggtatatttgcagtacccagtgtgattttactgaatacaggtggtaataagctgata
tattttgcgatctgggtttttagcgctgcgatcgcttttgcaggattgtatctttttcta
gaatttggttcctggataccgaaatcaggtggacgtaaaaacttcctcgaacggagtttt
gaaagacccagactattaattagtgtggtgttttcgtgttacagtgttttaactggctat
gcattgacgggatctatcgtcttcggtaaatacgtgttgagcgcatttggagtcacggat
gattcgtggtccaagtacgtcagcatatcatttataatatttgccgttctcattcacggt
gtctctgtaaggcacggagtgtttatacagaacgcacttggtggtttgaagttgatcatg
attgtcttgatgtgctttgccgggctatacacgcttttcttttataaaagcaccggtcaa
gttgcctgggacctcccagtaacccaagttgagaaagattctctcctgtcggtgtcctct
attgctactgcctttatcagctcattcttttgtttttctggatgggatacagttcacaca
gttacatcagaaattaagaatcccgttaagacgttgaaggtgtcaggtcccttatcgttg
ataatttgttttgtctgctacacaatgatgaatgtggcatacttgaaagttttgacatat
gaggaaattgttagtgcaggccccctggttggttccgtgttgtttaccaaacttttcgga
cccagagttggtggcaaattcattgctttttctatcgccatttctgcagcatctaatatt
ctggttgtcatttacagtatatcaagagttaaccaggaaatattcaaagaaggttattta
ccattcagtattcatatgtccaaaaattggccatttgatgcacctctaccatctatttct
ttatgtggctttataaccattgcttggatattgattttacccaaagagggcgaatccttc
aattatctggtatcgatggatggttatggtaatcagtttttcttattattggtcgctatt
gggctctttatttggaggttcaaacacaagaacgaagtcccagagattcgtgcatctact
tttggagtattagccattattacattatcattatacatgttgatggcaccattctttgcc
gaccctagcctaaacagagttgggttcctgccgccctaccaaatcatgtcattactggta
atagttgcatgcttctttttctggttagttaaattcgttttactacctaaattcttccat
tataaacttttacccaaaatcacttatttgcatgatgggctcattgtcacagaatgggtg
aaaaagccatgtctgtgttag

DBGET integrated database retrieval system